KEGG   Nonlabens sp. MJ115: EJ995_12070Help
Entry
EJ995_12070       CDS       T05856                                 

Definition
(GenBank) HAD family phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
noj  Nonlabens sp. MJ115
Pathway
noj00010  Glycolysis / Gluconeogenesis
noj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:noj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EJ995_12070
Enzymes [BR:noj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     EJ995_12070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like OEP
Motif
Other DBs
NCBI-ProteinID: AZQ44924
UniProt: A0A3S9N0L7
Position
2666949..2667572
Genome map
AA seq 207 aa AA seqDB search
MPIKNIIFDFGDVFIDLDKTFVFKQMPVDDQEAREHLQLVNEKYEVGAITTVDFLDGIQS
IYPQASHEELKNIWNRMLLGYPDYRLEFIENLATTHKYRLFLLSNTNELHIENVAQQMGD
SKYRRFKSCFERFYLSHEIGLRKPNTDIFEFVLRQNRLSPDETLFIDDTLEHTLTAKSLG
IHTWHLKVDEDVVDLKNHIDTYNNLTQ
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgcccataaaaaatatcatcttcgattttggagatgtgtttattgatctagacaaaacg
tttgtttttaaacagatgccagtagatgatcaggaagctcgtgaacacttacaactagtc
aatgagaagtacgaagttggtgcaattacaaccgtagattttttagatggtattcaatct
atatatccacaagcgtctcatgaggaactaaagaacatctggaatagaatgctactaggg
tatccagattataggcttgagtttattgagaatcttgccaccacacataagtacagattg
tttttactgagtaatactaacgagctgcatattgagaatgtagcgcaacaaatgggcgac
agcaaataccgtaggttcaaatcgtgctttgaaaggttttacttatcgcatgagatcggc
ctacgtaaacctaatactgacatttttgaatttgtacttcgtcaaaacaggctttctcct
gatgaaaccttgttcattgacgataccttggagcataccttgacggcaaaaagtctgggc
attcatacttggcatttgaaagttgatgaggatgtggttgatcttaaaaatcatatcgat
acatataataatttaacgcaataa

DBGET integrated database retrieval system