KEGG   Noviherbaspirillum sp. UKPF54: FAY22_11235Help
Entry
FAY22_11235       CDS       T06116                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
nok  Noviherbaspirillum sp. UKPF54
Pathway
nok00790  Folate biosynthesis
nok01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nok00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FAY22_11235
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nok04147]
    FAY22_11235
Enzymes [BR:nok01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     FAY22_11235
Exosome [BR:nok04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FAY22_11235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: QDZ28471
UniProt: A0A5B8N644
Position
2436405..2436755
Genome map
AA seq 116 aa AA seqDB search
MVTANELLKKRCRHLDTGLSDAQIKEHLAAVDGWSLQDGKVAKTFSFANYYETLAFVNAI
AYVIHAEDHHPELAVTYNRCVVKFDTHSVNGGRGGISENDFICAAKVDAVFHQRAA
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggttaccgccaacgaactgttgaaaaagagatgccggcatctggataccggcctgagc
gatgcccagatcaaggagcatcttgccgccgtcgacggctggtcgctacaggatggcaag
gtcgccaagaccttcagcttcgcgaactactacgaaacgctggctttcgtaaatgcgatc
gcctacgtgatccatgccgaagaccatcatccggaactggccgtcacctataaccgctgc
gtcgtgaagttcgacacgcattcggtgaacggcggacgcggcggcatctccgagaacgac
ttcatttgtgcggccaaggtggacgccgtgtttcaccagcgcgcggcctga

DBGET integrated database retrieval system