KEGG   Noviherbaspirillum sp. UKPF54: FAY22_19370Help
Entry
FAY22_19370       CDS       T06116                                 

Definition
(GenBank) aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
  KO
K01740  O-acetylhomoserine (thiol)-lyase [EC:2.5.1.49]
Organism
nok  Noviherbaspirillum sp. UKPF54
Pathway
nok00270  Cysteine and methionine metabolism
nok01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nok00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    FAY22_19370
Enzymes [BR:nok01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.49  O-acetylhomoserine aminocarboxypropyltransferase
     FAY22_19370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_1_2 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: QDZ29929
UniProt: A0A5B8N932
Position
4198708..4199994
Genome map
AA seq 428 aa AA seqDB search
MKIETLAVHAGYTPDPTTKSVAVPIYQTVAYAFDSAQHGADLFDLKVPGNIYTRIMNPTQ
DILEKRVAALEGGIAALAVASGMAAITYAVQTICEAGDNIVSASTLYGGTYNLFAHTLPQ
MGIQARFADSRKPESFAPLIDGRTKAIFCESVGNPLGNVTDIAKLADIAHAHGIPLIVDN
TVPSPYLCRPFEHGADIVVHALTKYLGGHGNSIGGAIVDSGKFPWAEHKERFKRLNEPDV
SYHGVVYTEALGPAAYIGRARVVPLRNMGAAISPMNSFLILQGIETLALRMDRICDNALA
IARHLKSHPKVAWVNYAGLEDHPDHALVQKYMEGKASGILSFGLKTADKTDPRAAGARVL
DAMKLFTRLVNIGDAKSLVTHPASTTHRQLNAEELAKAGVSEDMLRLSVGIEHIDDLISD
LDQALAAA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgaaactcttgcggtgcacgccggttatacgcccgatccgacgacgaagtcg
gtggcggtgccgatctaccagacagtggcttacgcgttcgatagcgcgcagcatggtgcc
gacttgtttgacctgaaagtgccgggcaatatctacacccgcatcatgaacccgactcag
gatatcctggaaaagcgtgttgcagccctggagggcggcatcgccgcgctcgccgtcgcc
tccggcatggccgccatcacctacgccgtccagaccatctgcgaagccggcgacaacatt
gtttccgccagcacgctgtacggcggcacgtataacctgtttgcgcatacgctgccgcaa
atgggcatccaggcgcgcttcgccgactcgcgcaagccggaaagctttgcgccactgatc
gatggccgtaccaaggcgatcttttgcgaatcggtcggcaacccgctgggcaatgtcact
gatatcgccaagctggccgacatcgcgcatgcgcatggcattccgctcatcgtcgacaac
accgtgccgagcccttatctgtgccgtccgttcgagcacggcgccgacatcgtcgtgcac
gcgctcaccaagtacctgggcggccacggcaacagtatcggcggcgcgatcgtcgacagc
ggcaaattcccgtgggccgagcacaaggagcgtttcaagcgcctcaacgaacccgatgtt
tcgtatcacggcgtggtctataccgaagcgctgggcccggccgcgtacatcggacgcgct
cgcgtcgtcccgttgcgcaacatgggcgcggcgatctcgccgatgaattccttcctcatc
ctgcagggcatcgaaacgctggcgctgcgcatggaccgcatttgcgacaatgcgttggcg
atcgcgcggcacctcaaatcacaccccaaggtcgcctgggtcaactacgccgggctggaa
gaccacccggaccatgcactggtgcagaaatacatggaaggcaaggcgtccggcatcttg
tccttcggactaaaaacggcggacaaaaccgacccgcgcgccgccggcgcccgcgtgctc
gacgcaatgaagctgtttacgcggctggtcaacatcggcgatgccaagtccctggtcacc
catccggcatcgaccacgcatcgtcagctcaacgcggaagaactggcgaaagcgggcgta
tcagaagacatgctgcgcctgtctgtcggaattgagcatatcgacgatctgatttctgat
ttggatcaggcgctggcagcggcataa

DBGET integrated database retrieval system