KEGG   Noviherbaspirillum sp. UKPF54: FAY22_20620Help
Entry
FAY22_20620       CDS       T06116                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
nok  Noviherbaspirillum sp. UKPF54
Pathway
nok03010  Ribosome
Brite
KEGG Orthology (KO) [BR:nok00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    FAY22_20620
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nok03011]
    FAY22_20620
Ribosome [BR:nok03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    FAY22_20620
  Bacteria
    FAY22_20620
  Archaea
    FAY22_20620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: QDZ30148
Position
4477008..4477337
Genome map
AA seq 109 aa AA seqDB search
METKATLRGARLSAQKGRLVADLIRGKKVDQALNILAFSPKKGAVIIKQVLESAIANAEH
NDGADIDELKVKTIYVEKGAVLKRFIARAKGRGDRFSKQTCHIYVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaaactaaagctactctccgtggcgcgcgcctgtcggcccaaaaaggccgtcttgtc
gccgatctgatccgcggcaaaaaagttgatcaagcgttgaatatcctggccttcagcccg
aaaaagggcgcggtcatcatcaagcaggtgctggagtccgccattgcgaacgccgagcac
aacgatggtgcggatatcgacgaactgaaagtcaagacgatctacgtcgaaaaaggtgcg
gtcctcaagcgcttcatcgcgcgtgcaaaaggccgtggtgatcgcttctcgaagcaaacc
tgtcacatctacgtgactgtcggtaactaa

DBGET integrated database retrieval system