KEGG   Nonlabens sp. MIC269: AAT17_01155Help
Entry
AAT17_01155       CDS       T04144                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
nom  Nonlabens sp. MIC269
Pathway
nom00260  Glycine, serine and threonine metabolism
nom01100  Metabolic pathways
nom01110  Biosynthesis of secondary metabolites
nom01120  Microbial metabolism in diverse environments
nom01130  Biosynthesis of antibiotics
nom01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nom00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AAT17_01155
Enzymes [BR:nom01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AAT17_01155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP Pyridoxal_deC Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ALM19959
Position
complement(242258..243277)
Genome map
AA seq 339 aa AA seqDB search
MIDLRSDTVTKPTKGMLEAMMSADVGDDVYKEDPTAIKLENRIAEMFGMDEALYFPTGSM
ANQAAIKLHTQPGEQLICDKYAHVYHYEGGGVSFNSGVSCKLLDGDRGKITASQVEAAIN
PPDFYHSPLTTLVTLENTTNKGGGACYDLNNIKEIKEVCNKHGLGLHLDGARLWNALVAT
GQDPKEYGQLFDTISVCLSKGLGAPMGTVLCGKSSLMKNAMRVRKVLGGGMRQIGYMCAA
GLYAVENHIDRLKEDHHKAQELKEVLQKMSFVKKVEPVETNIIIFEVKDQNEFMTFCNAK
KMTISNMGEGKMRFVTHYDYDSLQHREVINNLIEFNSIS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgatagatttacgtagtgataccgttaccaaacctacaaaaggaatgctagaagctatg
atgagtgccgatgtaggtgatgatgtatacaaagaagaccctacggcaataaaactagaa
aaccgcattgccgaaatgtttggtatggacgaggcattgtattttcctactggtagtatg
gcaaaccaagctgcaatcaaattacacacgcaacctggcgagcagcttatatgcgataag
tatgcacatgtttatcattatgaaggtggtggcgtttcctttaatagtggagtaagttgt
aagttattggatggtgatagaggaaagatcaccgcttcacaagtagaagcagcaattaat
cctccggatttttatcatagtcctcttacgaccttagtaactcttgaaaatacaactaat
aaaggcggtggtgcttgttatgatttaaataacattaaagaaattaaagaagtttgcaat
aaacatgggttaggtcttcatcttgatggggctagattgtggaatgctctagttgctact
ggtcaagaccctaaagaatatggccaattatttgatactatatctgtttgtttaagcaaa
ggattgggcgcacctatgggcacggtactttgtggtaaatcttcattgatgaaaaatgca
atgcgagtgcgcaaggtgttaggcggtggtatgagacaaataggctatatgtgtgctgct
ggattatatgctgttgaaaatcatattgatcgattaaaagaagatcatcataaagcgcaa
gagcttaaagaagtcttgcaaaaaatgtcatttgttaaaaaagttgagcctgtagaaact
aatatcatcatttttgaagtaaaagatcaaaatgaatttatgacattttgtaatgcaaaa
aaaatgacaattagtaacatgggtgaaggtaaaatgagatttgttactcattatgactac
gattctttacaacatcgtgaagtaattaacaatttgattgaatttaattcaattagttaa

DBGET integrated database retrieval system