KEGG   Nostoc sp. NIES-3756: NOS3756_07810Help
Entry
NOS3756_07810     CDS       T04170                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
non  Nostoc sp. NIES-3756
Pathway
non00860  Porphyrin and chlorophyll metabolism
non01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:non00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NOS3756_07810
Enzymes [BR:non01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     NOS3756_07810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA SNO DUF1611 GATase GATase_5
Motif
Other DBs
NCBI-ProteinID: BAT51851
Position
complement(907618..909159)
Genome map
AA seq 513 aa AA seqDB search
MALASRREAVSYYELQINQEVAMKSIMVVGTTSHAGKSLISTAICRILSRRGWRVAPFKG
QNMALNAYVTSNGGEIGYAQAVQAWAAGVIPWVEMNPILLKPQGDMTSQVIIRGRPVGRV
SAVDYYEQYFDIGWRAIEESLQHLGTEFDLIVCEGAGSPAEINLKHRDLTNMRVAKYLNA
PTLLVVDIDRGGAFAHVVGTLELLEPEERQLIKGVVINKFRGQRSLLDSGIKWLEERTGI
PVVGVIPYIQEIFPAEDSLDLLERKTHKAQADLNISVVRLPRIANFTDFDPLESEPTVSV
RYISPKQDLGHPDAVILPGTKTTIADLILLQKTGMAEAIQNYAASGGTVLGICGGYQMLG
QIIADPEGIEGQAGRYQGLNLLPIRTVITGQKIARQRQVSSNFPQMGLPVNGFEIHQGRS
RVEPQGDSKAFQPLFDDVNLGLVDSCQSVWGSYLHGLFDNGPWRRAWLNRLRQQRGLKSL
PTGVANYREQREHMLDNIATEVESHLDLTPFLP
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
ttggcgttagcctctcgtagagaagccgtaagctattacgaattacaaattaatcaagaa
gtggctatgaaatcaataatggtagtggggacaacatcccatgcagggaaatcactgata
agtacggctatttgtcgcattttgtcgcggcgtggttggcgagtagccccgtttaaggga
caaaatatggcattgaatgcttatgtcacctcaaatggcggggaaattggctacgcgcaa
gcagtacaagcttgggcagcaggggtgataccttgggtagaaatgaacccgattttactc
aagccccaaggcgatatgacatcccaggtcattatccgaggcagacctgtagggagagtc
agcgccgtcgactattatgagcagtattttgacatcggttggcgcgccattgaagaatct
ctacaacatctgggaactgaatttgatttaatcgtttgtgaaggtgcgggtagtccagca
gaaattaacctcaagcaccgcgatttaactaatatgcgggtagccaaatacttaaacgcc
cccaccctattggtcgttgatattgaccgtggtggtgcttttgctcacgtagtcggcaca
ctagaattattagaaccagaagaacgccaactaattaaaggcgtagtcattaacaaattt
agaggacagcgatcgctcttagattcgggaatcaaatggttagaagaacggactggtatt
cctgtggtcggtgttatcccttacatccaagaaatcttccccgccgaagattccctagat
ttactagaacgcaaaacacataaagcccaagctgacctgaatatatcagttgttcgtcta
cctagaattgccaactttaccgactttgaccccttagaatcagaacccactgtttcagtt
agatatatcagcccaaaacaagacttgggacatcccgatgcagtaattctcccaggtacg
aaaactacaattgccgacttgatcctcctacaaaaaacaggtatggcagaagccatccaa
aactatgccgcttctggtggtacagtgttggggatttgcggtggctaccaaatgctaggg
caaatcatcgccgatccagaagggatagaagggcaagctggcagatatcaaggcttaaac
ctcctgccaattagaaccgtgatcacaggacaaaaaattgcccgtcagcgccaagttagc
tcaaacttcccgcagatgggcttaccagtcaacggcttcgagattcaccaagggcgatcg
cgtgtagaaccccaaggtgatagtaaagccttccaacctttgtttgatgatgttaactta
gggttagttgatagttgccaatctgtatggggtagttatctacacggtctatttgataat
gggccttggagacgcgcttggttaaatcgtctgcgtcaacagcgtggtttaaaatctcta
cctacaggtgtggctaactacagagaacaacgagagcatatgttagataatatagctact
gaagtagaaagccatttagatttaacacccttcctgccctag

DBGET integrated database retrieval system