KEGG   Nostoc sp. NIES-3756: NOS3756_17120Help
Entry
NOS3756_17120     CDS       T04170                                 

Gene name
rbcS
Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
non  Nostoc sp. NIES-3756
Pathway
non00630  Glyoxylate and dicarboxylate metabolism
non00710  Carbon fixation in photosynthetic organisms
non01100  Metabolic pathways
non01110  Biosynthesis of secondary metabolites
non01120  Microbial metabolism in diverse environments
non01130  Biosynthesis of antibiotics
non01200  Carbon metabolism
Module
non_M00165  Reductive pentose phosphate cycle (Calvin cycle)
non_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
non_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:non00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NOS3756_17120 (rbcS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NOS3756_17120 (rbcS)
Enzymes [BR:non01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     NOS3756_17120 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small Guanylate_cyc_2
Motif
Other DBs
NCBI-ProteinID: BAT52771
Position
1955797..1956126
Genome map
AA seq 109 aa AA seqDB search
MQTLPKERRYETLSYLPPLTDVQIEKQVQYILNQGYFPAIEFNEQSEPTEYYWTLWKLPL
FNAKSTREVLAEVQSCRSQYPGHYIRVVGFDNIKQCQILSFIVHKPSRY
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccttaccaaaagagcgtcgttacgaaaccctttcttacttacctcccctcacc
gatgttcaaattgaaaagcaagttcagtacattctgaaccaaggctactttccagccatt
gagttcaacgaacaatctgaacctaccgaatattactggacactgtggaagctacccctg
ttcaacgctaaaagcacccgcgaagtattggcagaagttcaatcttgtcgttctcaatat
cctggccactacatccgtgtagtaggatttgacaacatcaaacagtgccaaatcctcagc
ttcatcgttcacaaacccagcagatactaa

DBGET integrated database retrieval system