KEGG   Nostoc sp. NIES-3756: NOS3756_35760Help
Entry
NOS3756_35760     CDS       T04170                                 

Definition
(GenBank) putative phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
non  Nostoc sp. NIES-3756
Pathway
non00030  Pentose phosphate pathway
non00710  Carbon fixation in photosynthetic organisms
non01100  Metabolic pathways
non01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:non00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NOS3756_35760
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NOS3756_35760
Enzymes [BR:non01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     NOS3756_35760
    4.1.2.22  fructose-6-phosphate phosphoketolase
     NOS3756_35760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP_C XFP Vta1_C TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: BAT54604
Position
4169083..4171464
Genome map
AA seq 793 aa AA seqDB search
MTLASPPQIKPLTDEELHKINAYWRAANYLSVGQIYLLDNPLLREPLKIDHVKPRLLGHW
GTTPGLNFIYVHLNRIIKKYDQSMIYIAGPGHGGPGLVANTYLEGTYSEYYSNISQDAEG
MQKLFKQFSFPGGIPSHVAPETPGSIHEGGELGYALVHAFGAAFDNPDLIVAAVVGDGEA
ETGALATSWHSNKFLNPANDGAVLPILHLNGYKIANPTVLARISHEELDSLFVGYGYKPY
YVEGSDPAVVHQQMAATLDTVIAEIHGIQREARVHGFTKRPQWPMIILRTPKGWTGPKEV
DGKKTEDYWRSHQVPFGNISGQPEHLKLLEEWMKSYKPEELFDENGTLIAELAELAPKGQ
RRMGDNPHANGGILLRDLIMPDFRNYAVEVPKPGTVFAEATQVAGKLLRDVMQRNLDSRN
FRIFGPDETASNRINAVLDVTDRTWVAETLPEDDHLDPNGRVMEILSETCCQGWLEGYLL
TGRHGFFSCYEAFIHIIDSMFNQHAKWLKTTRDISWRRPIASLNYLLTSHVWRQDHNGFS
HQDPGFLDHVTNKKSEIIRVYLPPDANTLLSVTDHCLRSRNYVNVIVAGKQPALQYLDMD
AAIKHCTKGIGIWEWASNDQGGEPDVVMACAGDVPTLETLASVDILRRNFPDLKVRVVNV
VDLMTLQPKTEHPHGLSYKDFDTIFTTDKPIIFAFHGYPWLIHRLTYRHTNHNNLHVRGY
KEEGTTTTPFDMVVLNDLDRFHLAMDVIDRVPKLGAKAAYVKQHLQDKLIEHKQYIAKYG
EDMPEISDWQWPY
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgactttagcaagtcctccacagataaagcctttaaccgatgaagaactgcataaaatc
aacgcctattggcgtgcagccaactatttatcagttggacaaatatatctccttgataat
cccttactcagagaaccactgaaaatagaccatgtgaagccccgtctattaggtcattgg
ggaacaacaccgggtttgaactttatttatgtccacctcaacaggattattaaaaaatac
gaccaaagtatgatttacattgccgggcctggtcatggtgggcctggactggtagcgaat
acttatcttgaagggacatatagcgagtactactccaacatctcccaagatgcggagggg
atgcagaaactattcaaacagttctcctttcccggcggtattcctagccacgttgcgccg
gaaacccctggttccatccatgaaggtggtgaactcggttatgcccttgttcatgctttt
ggtgcggcttttgataatcccgacttaattgtggcggctgttgttggtgatggtgaagct
gaaactggcgcattggctacaagttggcattccaacaagtttctcaacccagctaatgat
ggggctgtattgccgattctacatttaaacgggtataaaattgctaaccccacagtctta
gcacggattagccatgaagaattagacagtttgtttgttggctatgggtacaagccttac
tatgttgagggttctgatcccgcagttgtgcatcaacaaatggcagcaactttagataca
gtcattgccgaaatccacggtattcaaagagaagcccgtgtacatgggtttaccaagcgt
ccccagtggccgatgattatcttgagaacgcccaaaggctggacagggccaaaagaagta
gatgggaaaaaaacagaagattactggcgatcgcaccaagtacccttcggtaatatatca
ggtcaaccagaacacctgaaactcctggaagaatggatgaagagttacaaaccagaagaa
ctcttcgacgagaacggtacactcatagccgaattggcagaattagcccccaaaggtcaa
cgccgcatgggagacaatccccacgccaacggcggtattctgttgcgtgacttaatcatg
ccagactttaggaactatgcggttgaggttcccaagccaggaacagtatttgccgaagcc
acccaagtagctggcaaactcctacgcgatgtcatgcaacgcaacctagacagccgtaac
ttccgcatcttcggccctgatgaaactgcatctaaccgcatcaacgccgtcttagatgtc
acagataggacatgggttgccgaaactctcccagaagacgaccacctcgaccccaatgga
cgagtgatggaaattctcagcgagacttgctgtcaaggatggttagaaggatatttgcta
acaggtcgtcatggtttcttctcctgttacgaagcctttatccacatcatcgactcaatg
ttcaaccagcacgccaaatggttgaaaaccacccgcgacatctcttggcgcagaccaatt
gcttccctcaactatttgttaacttcccacgtttggcgacaagaccacaacggcttctct
caccaagacccaggttttctcgaccatgtaactaacaaaaaatctgagattatccgtgtc
tatcttccacccgatgccaacaccttactatcggtgacagaccactgcttacgcagccgg
aactatgtcaacgtcattgttgcaggcaaacaaccagccctacaatatttagatatggat
gcagcaattaaacactgcaccaaaggtattggcatttgggaatgggctagtaacgaccaa
ggcggtgaaccagatgtagttatggcttgtgctggcgatgttcctaccttagaaaccttg
gcatctgtggacattttacgccgcaacttccccgacttaaaagtgcgggtagtcaacgtt
gtagacttgatgacactacaacccaaaaccgaacatccccacggtttaagttataaagac
ttcgatacgattttcaccaccgacaaacccatcatcttcgctttccacggctacccttgg
ttaattcaccgcttaacttatcgccacaccaaccacaacaacctccatgtgcggggctac
aaagaggaaggaactaccaccacaccctttgatatggttgtgctgaacgaccttgaccgc
ttccacttagcaatggacgtaattgatcgcgtaccaaaattgggtgctaaagcagcttac
gttaagcaacatctacaagacaagctgatcgaacacaaacaatacatcgctaaatatggc
gaagatatgccagaaattagtgactggcagtggccatattaa

DBGET integrated database retrieval system