KEGG   Nostoc sp. NIES-3756: NOS3756_41240Help
Entry
NOS3756_41240     CDS       T04170                                 

Gene name
chlL
Definition
(GenBank) protochlorophyllide reductase iron-sulfur ATP-binding protein ChlL
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
non  Nostoc sp. NIES-3756
Pathway
non00860  Porphyrin and chlorophyll metabolism
non01100  Metabolic pathways
non01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:non00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NOS3756_41240 (chlL)
Enzymes [BR:non01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     NOS3756_41240 (chlL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MipZ AAA_24 MeaB AAA_25 AAA_26 SRP54
Motif
Other DBs
NCBI-ProteinID: BAT55145
Position
complement(4811769..4812635)
Genome map
AA seq 288 aa AA seqDB search
MKLAVYGKGGIGKSTTSCNISVALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQE
KDYHYEDVWPEDVIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVIL
FDVLGDVVCGGFAAPLNYADYCMIVTDNGFDALFAANRIAASVREKARTHPLRLAGLIGN
RTSKRDLIEKYVESVPMPVLEVLPLIEDIRVSRVKGKTLFEMAESDPSLNYVCDYYLNIA
DQILARPEGVVPNDAPDRELFTLLSDFYLNPRKPQVANPEEELDLMIV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactagcagtctacggaaaaggtgggataggcaaatccacaactagctgtaatata
tccgtcgccctagccaaacgcggtaagaaagtgctgcaaatcgggtgcgatcctaaacat
gacagtaccttcaccttaacggggtttttaattcccacaattatcgataccctgcaagag
aaagattatcactatgaagatgtttggccagaagatgtcatttacaagggctatggtggt
gtagactgcgtagaagctggcggcccacctgcgggtgctggatgtggcggttatgtcgta
ggtgagacagtaaaattactgaaagaactcaacgcttttgatgaatacgatgtcatcttg
tttgatgttcttggtgacgtagtttgtggtggttttgctgcaccactcaactatgctgat
tactgcatgattgttacagataacggctttgatgccttatttgcagcaaatcggattgcg
gcttcagtgcgagagaaagccaggactcatcccctacgtttagctgggttgattggcaac
cgcacctccaagcgcgacttgattgaaaaatatgtggaatccgtgccaatgccagtattg
gaggttttgccattaattgaagatattcgcgtttctcgcgttaaaggtaaaactttattt
gaaatggcagagtcagatccttctctgaactacgtttgcgactactaccttaacattgcc
gaccagattttagcgcgtcctgagggagtcgttcccaatgatgcccctgatcgtgaatta
ttcactttattatcagatttttatctaaatccgcgtaaaccccaggttgctaatcctgaa
gaggaattagacttgatgattgtataa

DBGET integrated database retrieval system