KEGG   Nostoc sp. NIES-3756: NOS3756_46190Help
Entry
NOS3756_46190     CDS       T04170                                 

Definition
(GenBank) Nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
non  Nostoc sp. NIES-3756
Pathway
non00230  Purine metabolism
non00240  Pyrimidine metabolism
non01100  Metabolic pathways
non01110  Biosynthesis of secondary metabolites
non01130  Biosynthesis of antibiotics
Module
non_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
non_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
non_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:non00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NOS3756_46190
   00240 Pyrimidine metabolism
    NOS3756_46190
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:non04131]
    NOS3756_46190
Enzymes [BR:non01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     NOS3756_46190
Membrane trafficking [BR:non04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    NOS3756_46190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: BAT55626
Position
complement(5389505..5389954)
Genome map
AA seq 149 aa AA seqDB search
MERTFLAIKPDGVQRKLVGEIIRRFETKGFTLVGLKFLQVSKQLAEEHYGVHRERPFFSS
LVEFITSGPVVAMVWEGDGVIASARKIIGATNPLTAEPGTIRGDFGISIGRNLIHGSDAP
ETAQKEISLWFTDAELVNWQPHLTPWLHE
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
ttggaacgcacattcttagcaattaagcctgatggcgtacagcgtaaactcgttggcgaa
attatacgtcgctttgaaacaaaaggttttaccctcgtgggtttaaagtttctccaagtc
agtaaacaattggctgaagaacattatggtgtccacagagaaagacctttcttttccagt
ctagttgaatttatcacctctggcccggtggtagcgatggtttgggaaggtgatggtgtg
attgcttctgccagaaaaattattggtgcaaccaatcccctcacagcagaacccggaaca
attcggggtgattttggcattagcatcggccgcaacctcatccacggttctgatgcgcca
gaaaccgcacaaaaagaaatcagcctgtggtttacagatgcagaattagtcaattggcaa
ccacacttaaccccttggttgcacgagtag

DBGET integrated database retrieval system