KEGG   Nostoc sp. NIES-3756: NOS3756_59370Help
Entry
NOS3756_59370     CDS       T04170                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
non  Nostoc sp. NIES-3756
Pathway
non03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:non00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    NOS3756_59370
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:non03400]
    NOS3756_59370
Enzymes [BR:non01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     NOS3756_59370
DNA repair and recombination proteins [BR:non03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     NOS3756_59370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HHH_4 HHH_5 DNA_pol_lambd_f HHH_2 HHH Hjc DUF99
Motif
Other DBs
NCBI-ProteinID: BAT56925
Position
pNOS3756_1:413062..414261
Genome map
AA seq 399 aa AA seqDB search
MSTLPTAQQTQAQPHYETITGVVERLTFHSEESGYTVARLTRSRSTDLTTIVGNFANIQP
GQTLQLTGFWKDHPQYGPQFNVTNYHETKPATLTGIEKYLGSGLIKGVGPVTARRIVAHF
GLETLDIIENQIDRLIEVQGIAKKRIKLIKNAWETQKAIKEVMVFLQTHGVSTTYAVKIY
KQYQDQAIVTVTANPYQLATDIYGIGFLTADKIARNLGVPTSSEFRYSAGIIHALSEAAE
DGHCYVPQPELIEKVTKLLTTDDHQPTEEAIALIIKDMTTKEELVREFVRDSYGEKLLLC
YKPTFFHTEQNLAQLISRRLRQPVTQDIPRVRAWLDRFMSSRKIQLYIPLALIFLPLRRS
IVSSIPMMIGPVRKNTVTMSINKIRLASKPDHTARFNTR
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtccactctaccaacagcacaacaaacccaagcacaacctcactacgaaaccatcacc
ggggtagtcgaacgcctgactttccactcagaggaatcaggttacacagtcgcacgccta
acccgctctcgctccaccgacctcaccaccatcgtcggtaacttcgccaatatccagcct
gggcaaacgctacagctaacaggcttctggaaagaccatccgcagtatggcccacaattt
aatgtcactaactaccacgaaaccaaaccagctacactcactggaattgagaaatatctt
ggcagtggactaataaaaggggtaggcccagttacagcaagacgtatcgttgcacatttc
gggttagaaacactcgatatcatcgaaaaccagattgaccgccttatcgaagtacaaggc
atcgccaagaaacgcatcaagctaatcaagaatgcctgggagacgcaaaaggcgataaaa
gaggtgatggtgttcctgcaaactcacggagtttctacaacatacgccgtcaaaatatat
aaacaatatcaagatcaggcgatcgtcaccgtcaccgcgaacccgtaccaactagcaacc
gacatctacggcatcggctttctcactgctgacaagattgcgcgtaacctgggcgtacca
acaagctcagagtttcgatacagcgctggaatcatccacgcattgagtgaagcagccgaa
gatggacactgctatgtcccccagccggaactcattgagaaagttaccaagctgctgaca
accgatgaccatcagccgacagaggaagcgatcgccctcattatcaaagatatgacaacc
aaggaagaactagttagagaatttgtcagggacagctatggggagaaattattactttgt
tataagccgacgttcttccacacagaacaaaaccttgcacagttgatatctcgacggtta
cgccagccagtgacacaagatatccctcgtgtccgtgcatggctagaccgcttcatgtcc
agccgcaaaatccagctatatattcctttggccttaattttcttgcctttacgacgttca
atcgtatcatctattcccatgatgattggcccagttcgtaaaaacactgttaccatgagc
attaataaaattcggcttgcttccaaacctgaccacactgcgcgatttaatacacgatga

DBGET integrated database retrieval system