KEGG   Nostoc sp. PCC 7524: Nos7524_0760Help
Entry
Nos7524_0760      CDS       T02363                                 

Definition
(GenBank) phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
nop  Nostoc sp. PCC 7524
Brite
KEGG Orthology (KO) [BR:nop00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Nos7524_0760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 PreAtp-grasp
Motif
Other DBs
NCBI-ProteinID: AFY46665
UniProt: K9QM04
Position
complement(879559..880518)
Genome map
AA seq 319 aa AA seqDB search
MLLVSIFIATLFLAYAKGANDNFKGVATLFGSRTTSYQTAILWATLTTFAGALTSTFLTS
KSVIKFSGQGILDDAIASRTEFHLAVVIATALTVLLATFLGLPVSTSHSLIGAVLGAALV
AIGLKANFTVLGSSLIAPLFFSSILAIPLATGTYSLVDYINSRFHLQPSQKLIDICHYIS
AGLINFARGFHHTYQLVTLVVIIDYFSIKGAMITIAMAMALGGLLNSQKVAETISIKITP
MNSIQGLSANVVTSTLVIAASYFGLPVSTTHVAVGSIFGVGVMTNKVNKLVCWQIVLAWI
FTLPVATIIGGITYRLLQR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgttgttagtaagtatatttatcgctacgctattcctggcttatgctaaaggagcaaac
gacaattttaagggtgtagcaacgctgtttggcagtcgcaccactagctaccaaacagca
attttatgggcgactttgacgacttttgctggggcattaacatctacttttttaacaagc
aaatcagtgatcaagttttctgggcaagggatattagatgatgcgatcgctagtcggact
gaatttcatctggcggtagtaattgccacagctttaactgtattacttgccaccttttta
ggtttgcctgtttctacatcccacagtttaatcggtgctgtacttggtgctgcattagtt
gcgatcggactgaaggctaattttacagttttaggaagttccttgattgcacctctattt
tttagttctattctagcaattcccttggcaacaggaacctacagcttagttgactatatt
aattctcgattccatctacaaccaagccaaaaactcatcgatatttgtcattatatcagt
gctggactgatcaactttgctagaggttttcatcatacttatcaactcgtcactctagtt
gtaattattgattacttttccattaaaggtgcaatgattaccattgctatggctatggca
ctaggtggtttactcaattcacaaaaggttgctgaaactatcagtatcaaaattacaccg
atgaattccatacagggtttatcagccaatgtcgttactagcactttagtaattgcagct
agttatttcggtctacctgtgtctacaactcatgttgcagtcggttcgatttttggtgtg
ggtgtcatgactaataaagtcaataaattggtttgttggcaaattgtgctagcgtggatt
tttaccttacctgttgccacaattattggcggtataacctatagattattacaacgctaa

DBGET integrated database retrieval system