KEGG   Nostoc sp. PCC 7524: Nos7524_1322Help
Entry
Nos7524_1322      CDS       T02363                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nop  Nostoc sp. PCC 7524
Pathway
nop00010  Glycolysis / Gluconeogenesis
nop00053  Ascorbate and aldarate metabolism
nop00071  Fatty acid degradation
nop00280  Valine, leucine and isoleucine degradation
nop00310  Lysine degradation
nop00330  Arginine and proline metabolism
nop00340  Histidine metabolism
nop00380  Tryptophan metabolism
nop00410  beta-Alanine metabolism
nop00561  Glycerolipid metabolism
nop00620  Pyruvate metabolism
nop00625  Chloroalkane and chloroalkene degradation
nop01100  Metabolic pathways
nop01110  Biosynthesis of secondary metabolites
nop01120  Microbial metabolism in diverse environments
nop01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nos7524_1322
   00053 Ascorbate and aldarate metabolism
    Nos7524_1322
   00620 Pyruvate metabolism
    Nos7524_1322
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Nos7524_1322
   00561 Glycerolipid metabolism
    Nos7524_1322
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Nos7524_1322
   00310 Lysine degradation
    Nos7524_1322
   00330 Arginine and proline metabolism
    Nos7524_1322
   00340 Histidine metabolism
    Nos7524_1322
   00380 Tryptophan metabolism
    Nos7524_1322
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Nos7524_1322
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Nos7524_1322
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Nos7524_1322
Enzymes [BR:nop01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Nos7524_1322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AFY47203
UniProt: K9QP53
Position
1549697..1551166
Genome map
AA seq 489 aa AA seqDB search
MVTAKEPQQQVKIGPTRLLINNEWIESVSGRRFETINPATGEVICEVAEADAPDVDKAVK
AARTAFTSGEWSKLSAARRGELLYKLADLIEQNIDELARLETLDNGKPLQDSLGDLELVI
ACYRYYAGWADKVQGKTIPIGGSYFCYTRHEPVGVVGQIIPWNFPLLMQAWKLAPALATG
NTVVLKTAEQTPLSALRVGELIVEAGFPPGVVNILSGYGPTAGAAIARHMDIDKVAFTGS
TEVGHLIMEAAAKSNLKRVTLELGGKSPNIVFADADLDAAITGAHDAIFFNQGQCCCAGS
RLFVDEKCYDDFVAKSVEKAQSRIVGDPFDSNTQQGPQVDKDQFDKVMSYIESGMRQGAQ
MLCGGNQVGDKGFFIAPTVFADVRDDMQIAQEEIFGPVMSIIKFQDIEEVIQRANNTIYG
LAAAVWTQDITKAHAIANNVRAGTVWVNCYDVFDPAAPFGGFKQSGIGRELGEYGLQQYT
EVKTVTIKL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggtgacagcaaaggaaccgcaacaacaggtaaaaattggcccaactcgactgctaatt
aacaatgagtggatagaaagcgttagcggtcgcaggtttgagacgattaacccagccaca
ggtgaggtcatctgtgaagtagcagaagcagatgcgccagatgtagataaggcagtaaaa
gcagcccgtaccgcctttaccagtggggaatggtcaaagctatcagctgcccgtcggggt
gagttgctttacaagttagctgatttaatagaacaaaatattgatgaattggcgcggcta
gaaaccttagacaacggtaagccactgcaagattcattgggtgatttggaattagtgatt
gcctgctatcgctactatgcaggttgggctgataaggtacaaggtaaaactatccccatt
ggcgggtcgtacttctgttacactcgccatgaacctgtgggcgtagtcggtcaaattatc
ccctggaatttccccttgttgatgcaggcgtggaagctagcaccagctttagcaacaggt
aatactgttgtgttgaagacggcggaacagacaccattatcagcgttgcgggtgggagaa
ttgattgtagaagctggttttccccctggtgtggtgaatattttatcaggatatggcccc
acagccggagcagcgatcgctcgtcacatggatattgataaagtcgcgtttaccggttcc
actgaggtagggcatctaattatggaagcggctgccaaaagtaacctcaagcgggtaact
ctggaattgggcggcaagagtcccaacattgtgtttgctgatgctgatttagatgcagct
attacaggcgcacacgatgccatcttctttaaccaaggtcagtgttgctgtgcaggttcg
cggctatttgtggacgaaaaatgttatgacgattttgtcgccaagagtgtagaaaaagcc
caaagccgcattgtcggcgacccctttgatagcaacacccaacaaggcccccaagtagat
aaagaccaattcgacaaagtgatgagttatatcgaatcggggatgagacaaggggcgcaa
atgttatgtggtggtaatcaagtgggagacaaaggtttctttattgcccctacggtgttt
gctgatgtccgtgacgatatgcagattgcccaagaagaaatctttggaccggtgatgagt
attatcaaattccaagacatcgaggaagtaattcaacgggcaaataacaccatatacgga
ctcgccgccgcagtttggacacaggatattactaaagcccatgcgatcgctaacaacgtc
cgtgctggtacagtatgggtaaattgctacgacgtatttgacccagccgcaccctttggt
ggttttaagcaatccggtatcggtcgagaactgggtgaatatggtttgcaacagtacacc
gaagttaaaactgtcaccatcaagttgtaa

DBGET integrated database retrieval system