KEGG   Nostoc sp. PCC 7524: Nos7524_4932Help
Entry
Nos7524_4932      CDS       T02363                                 

Definition
(GenBank) ribosomal protein L22, bacterial type
  KO
K02890  large subunit ribosomal protein L22
Organism
nop  Nostoc sp. PCC 7524
Pathway
nop03010  Ribosome
Brite
KEGG Orthology (KO) [BR:nop00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Nos7524_4932
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nop03011]
    Nos7524_4932
Ribosome [BR:nop03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Nos7524_4932
  Bacteria
    Nos7524_4932
  Archaea
    Nos7524_4932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Neuromodulin
Motif
Other DBs
NCBI-ProteinID: AFY50658
UniProt: K9QYX8
Position
5873971..5874330
Genome map
AA seq 119 aa AA seqDB search
MATDTTEVKAIARYIRISPYKVRRVLDQIRGRSYREALIILEFMPYRATEPVLKLLRSAA
ANAEHNAGLDRTQLVITKAYADQGPVLKRFQPRAQGRAYQIRKPTCHITLAVAASTNAE
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggctacagatactactgaagtaaaggcgatcgcccgttatatacgcatttctccctac
aaagtacgtcgtgtacttgatcaaatccgggggcgctcctatcgggaagcactgatcatc
ctggaattcatgccttatcgagccactgagccagttttgaaactactcagaagtgccgcc
gctaacgctgaacataacgctgggttagatcgcactcagctagtaattactaaggcatat
gctgatcaaggccccgtactgaaacgtttccaacctagagcgcaaggtagagcttaccaa
attcgcaagccaacgtgtcacatcactttggcagttgccgctagtaccaatgctgagtaa

DBGET integrated database retrieval system