KEGG   Novosphingobium sp. ABRDHK2: FA702_02105Help
Entry
FA702_02105       CDS       T06038                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
nor  Novosphingobium sp. ABRDHK2
Pathway
nor00450  Selenocompound metabolism
nor00970  Aminoacyl-tRNA biosynthesis
nor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nor00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    FA702_02105
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    FA702_02105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nor01007]
    FA702_02105
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nor03016]
    FA702_02105
Enzymes [BR:nor01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     FA702_02105
Amino acid related enzymes [BR:nor01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   FA702_02105
Transfer RNA biogenesis [BR:nor03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    FA702_02105
 Prokaryotic type
   Other AARSs
    FA702_02105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: QCI92463
UniProt: A0A4D7D7B3
Position
398823..400400
Genome map
AA seq 525 aa AA seqDB search
MGEHYYVTTAISYPNGKPHIGHAYEAIAADVITRFQKSMGRDARLQTGTDEHGLKMAQKA
RELGVTPKQLSDEMSQYFIDMCDALNVDYDRFQRTTEPGHHLATQELWRRMEANGDLYLS
RYEGWYSIRDEAYYDESELVAGEGGEKLSPQGTPVEWTVEESWFFRLSAYGEKLLAHYRD
NPDFIRPESRRNEMIAFVSQGLRDLSVSRTSFDWGVKVPGSENHVMYVWVDALTNYLTGL
GWPEETAEYNDYWPANLHLIGKDIVRFHTIYWPAFLMSAGLPLPRQVFGHGFLLNRGQKE
SKSLGNVTDPLALAAQFGVDPLRYFFLREVAFGQDGSYSPEAIVTRCNAELANSYGNLVQ
RVLSMIFKNLDGKLGAFSSTEADEALLATVALACRDELPSAFADLNFSAGIDAWMRAVFA
CNQYIDEQAPWSLRKTDPERMRAVLLTLFMAIRDLTIAILPVVPAAANKVLDQLGIPLDT
RNIANLTDADWYMARVATGERLAQPVGAFPRLELPADAEGAETDA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaacattactacgttactaccgcgatcagctatcccaacggcaagccgcacata
ggccatgcctatgaggcgattgccgccgacgttatcacgcgcttccagaaatcgatgggc
cgtgacgcgcgcctgcagaccggaacggacgagcacggcctgaagatggcgcagaaggcg
cgcgaactgggtgtgacgccgaagcagctcagcgatgaaatgtcgcaatatttcatcgat
atgtgcgatgccttgaacgtcgattatgatcgcttccagcgcaccaccgaaccagggcat
caccttgccacgcaggaactgtggcggcgcatggaggccaacggcgatctttatctcagc
cgctacgagggctggtactcgatccgcgacgaagcctattacgacgagagcgaactcgtg
gcgggggaagggggcgagaagctctcgccgcagggaacgccggtcgaatggacggtcgag
gagagctggttcttccgcctatcggcctatggcgaaaagctgctggcgcactatcgcgac
aaccccgatttcatccggcccgaaagccgccgcaacgagatgatcgcgttcgtcagccag
ggcttgcgcgatctgtcggtctcacgcaccagctttgactggggcgtcaaggtgccgggc
agcgaaaaccacgtcatgtacgtgtgggtggatgcgctgacgaactacctgacagggctg
ggctggccggaggaaacggcggaatacaatgactattggccggcgaacctgcacctgatc
ggcaaggacattgtccgcttccacacgatctactggccggccttcctgatgagcgcaggc
ctgccattgccccggcaggtcttcggccatggcttcctgctcaaccgggggcagaaggaa
tcgaagtcgctcggcaacgtcaccgatccgctggcgctggccgcgcagttcggcgtcgat
ccgctgcgctatttcttcctgcgcgaagtcgcgttcgggcaggacggcagctattcgccc
gaagccatcgttacgcgctgcaacgccgagctggcgaacagctacggcaatctcgtccag
cgcgttctgtccatgatcttcaagaatctggatggcaaacttggcgcgttttcgagcact
gaggctgacgaagcgctgctcgctaccgtcgcgctggcctgccgcgacgagctgccgtcc
gccttcgccgatctcaacttctcggccgggatcgacgcgtggatgcgcgcggtgttcgcc
tgcaaccagtacatcgacgaacaggcgccgtggtccttgcgcaagaccgatccggagcgg
atgcgcgccgtgctgctgacgctgttcatggctatccgcgatctgaccatcgcgatcctc
ccggtggttccagctgcggcgaacaaggtgctggaccagttgggcataccactggacaca
cgcaacatcgccaatctcaccgatgcggactggtacatggcgcgcgtcgccaccggggag
cgcctggcgcagccggtcggcgcgttcccgcgcctcgaactgcccgccgatgccgaaggc
gcggaaacggacgcctga

DBGET integrated database retrieval system