KEGG   Novosphingobium sp. ABRDHK2: FA702_16380Help
Entry
FA702_16380       CDS       T06038                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
nor  Novosphingobium sp. ABRDHK2
Brite
KEGG Orthology (KO) [BR:nor00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    FA702_16380 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4962
Motif
Other DBs
NCBI-ProteinID: QCI94937
UniProt: A0A4D7DGL0
Position
3358972..3359370
Genome map
AA seq 132 aa AA seqDB search
MKQLFQHAAVTEGVTVRVAVNFLPEQSRVDAGKWFWVYHIRIENDSAQRFQLLSRHWRIT
DGRGNVNFVDGEGVVGEQPLLEPGQTHDYVSGCPLGTPQGSMEGHYTMQRPDGSLFEVAI
PFFPLAAPATAN
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagctcttccagcatgccgcagtgacggagggcgtgaccgtccgggttgcggtc
aatttcctgcccgaacaatcccgcgtcgatgcgggcaaatggttctgggtctatcacatc
cgcatcgagaacgactcggcgcagcggttccagcttctgtcgcgccactggcggatcacc
gacgggcgcggcaacgtgaacttcgtcgacggcgaaggcgtggttggcgaacagccgttg
ctcgaaccggggcagacgcacgattacgtttccggctgtccgctgggaacgccgcagggc
agcatggaagggcactacaccatgcagcgtccggacggatcgctgttcgaagtggcgatc
ccgttcttcccgctggccgctccggccaccgcgaactga

DBGET integrated database retrieval system