KEGG   Novosphingobium sp. ABRDHK2: FA702_20570Help
Entry
FA702_20570       CDS       T06038                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
nor  Novosphingobium sp. ABRDHK2
Pathway
nor00860  Porphyrin and chlorophyll metabolism
nor01100  Metabolic pathways
Module
nor_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:nor00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FA702_20570
Enzymes [BR:nor01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     FA702_20570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 BPL_N
Motif
Other DBs
NCBI-ProteinID: QCI96021
UniProt: A0A4D7DJ83
Position
pABRDHK22:580141..581601
Genome map
AA seq 486 aa AA seqDB search
MAGLMLQGTGSDVGKSVLVAGLCRALANRGVRVLPFKPQNMSNNAAVTVDGGEIGRAQAL
QALAARAAPHTDMNPVLLKPQADRMSQLVVHGRVRGTLGSADFREGRRSLLPEVLESWHR
LRARCDLVVVEGAGSPAEINLRDGDIANMGFARAAGVPVVLVGDIDRGGVIASLAGTRAV
LDPADAAMIRGFIVNKFRGDPALFADGYEAIGRLTGWPGFGLVPWIAATARLPSEDAVVL
DRAAPATPGRKLVACPILPRIANFDDLDPLRQEPEVEVAMVPPGTPIPAHAAMIVLPGSK
ATIADMAFLRAQGWDIDIHAHYRRGGAVLGICGGYQMLGRRIADPLGIEGDPRAIAGLGL
LDVETVLTPDKALRRVRGVALGAAFEGYEMHMGETTGPGAAHGFACLDGARADGAISADG
HVFGTYCHGLFAAPGLRAAVLARIGARSNGADHDHAVDAALDELAGELERHLDVDGLLAL
ARAGLA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggctggcctgatgctgcaggggaccggttccgacgtgggcaaatcggtgctggtcgcg
gggctgtgccgcgcgctggccaaccgcggcgtgcgcgtcctgccgttcaagccgcagaac
atgtcgaacaacgcggcggtcaccgtcgatggtggcgagatcgggcgggcgcaggcgttg
caggcgctggccgcacgcgccgcgccgcataccgacatgaatcccgtgctgctcaagccg
caggcggatcgtatgtcgcaactcgtggtccatggccgggtgcgcggcacgctgggatcg
gccgatttccgcgaagggcggcgcagcctgctgcccgaagtgctcgaaagctggcaccgc
ctgcgcgcgcgctgcgatctggtggtggtcgaaggcgccggctcgccggccgagatcaac
ctgcgcgatggtgacatcgccaacatgggcttcgcgcgcgcggcgggggtgccggtggtg
ctggtgggcgatatcgaccggggcggggtgatcgcgtcgctggcggggacgcgcgcggtg
cttgatccggccgacgcggcaatgatccggggcttcatcgtcaacaagttccggggcgat
cccgcgctgttcgccgatggctacgaggcgatcggccggttgacgggctggccgggcttc
gggctggtgccctggattgcggccaccgcccggttgcccagcgaggatgcggtggtgctc
gaccgcgcggccccggccacgccagggcgcaagctggtcgcctgcccgatcctgccgcgc
atcgccaacttcgatgatctcgatcccttgcggcaagagccggaggtggaggtagcgatg
gttccgcccggcacgccgatccccgcccatgccgcgatgatcgtgctgcccggatcaaaa
gcgacgatcgccgacatggccttcctgcgcgcgcagggctgggacatcgacatccatgcc
cattaccggcgcggcggcgcggtgctggggatctgcggcggataccagatgcttggtcgc
cggatcgccgatccgctggggatcgagggcgatccgcgcgccatcgccgggcttggcctt
ctggacgtggaaaccgtgcttacgccggacaaggcgttgcggcgcgtgcggggcgtggcg
ctcggcgcggcgttcgagggctacgagatgcatatgggcgaaaccacggggccgggcgcg
gcgcatgggttcgcctgtctggacggcgcgcgcgccgatggagcgatcagcgccgacggg
catgtgttcggcacctattgccacggcctgttcgccgcacccggcctgcgcgcggccgtg
ctggcgcggatcggcgcgcgctcgaacggcgcggaccacgatcatgcggtcgacgccgcg
ctcgacgaactggcgggcgagctggagcggcatctcgatgtcgacggcttgctggcgctc
gcgcgggcgggccttgcatga

DBGET integrated database retrieval system