KEGG   Nostoc sp. PCC 7107: Nos7107_0117Help
Entry
Nos7107_0117      CDS       T02362                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00260  Glycine, serine and threonine metabolism
nos00750  Vitamin B6 metabolism
nos01100  Metabolic pathways
nos01110  Biosynthesis of secondary metabolites
nos01120  Microbial metabolism in diverse environments
nos01230  Biosynthesis of amino acids
Module
nos_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nos7107_0117
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Nos7107_0117
Enzymes [BR:nos01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Nos7107_0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP NinF
Motif
Other DBs
NCBI-ProteinID: AFY40808
UniProt: K9Q629
Position
142335..143639
Genome map
AA seq 434 aa AA seqDB search
MTQATSTHTQTTTATLEALKCKECGAEYELKASHVCEFCFGPLEVKYNYNNIRLSVSREK
IQAGPNSIWRYREFLPVATDNVIDVGTGMTPLVRSQRLARRLGLNKLYIKNDAVNMPTLS
FKDRVVSVALSRARELGFTTVSCASTGNLANSTAAIAAHAGLDCCVFIPSDLEAGKVLGS
LIYSPTLMAVKGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLGFEVAEQLGWEL
PDHIVAPLASGSLFTKIYKGFKEFVEVGLVEGKNVRFSGAQAEGCSPIAQAFREDRDFIK
PVKPNTIAKSIAIGNPADGVYAVEIAKKTGGNIESVTDAEIIEGIKLLAETEGIFTETAG
GTTVAVLKKLVEAGKIDPNETTVVYITGNGLKTQEAIQGYVGEPLTIDAKLDSFERALER
SRTLDRLEWQQVLV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggcaacctccacacacacccaaacaaccacagccaccttagaagctttgaag
tgtaaggaatgtggcgcggaatacgaacttaaagccagtcatgtttgtgagttttgcttt
gggccgttggaagtgaaatataactacaacaatatccgcctgagtgttagccgcgaaaaa
atccaagccgggccaaattcaatctggcgctatcgggaatttttacctgttgcaactgac
aatgtaattgatgtgggaactgggatgactcctttggtgcgttcccaacgtttggcgcgt
cgcctgggtctgaataagctttacattaaaaatgatgccgtcaacatgcccaccctcagc
ttcaaggatcgggtggtatcggtggcgctgtctcgcgcacgagagttaggttttacgaca
gtatcttgtgctagtactggtaacttagcaaattctacagctgcgatcgcagcccatgca
ggtttagactgttgcgtgttcatcccctctgatttagaagcaggcaaagttttaggtagc
ttgatttacagcccaactcttatggctgttaaaggcaattatgatcaagtaaaccgcctg
tgttcagaagttgcaaatacacatggttggggttttgtgaacattaatctgcgcccttac
tactctgaaggttccaaaactcttggctttgaagttgcagaacaacttggttgggaactc
ccagatcatatagttgcgcctttggcttctggttcgctgtttaccaaaatctataaaggc
ttcaaagaatttgtcgaagttggtttggtagaaggtaaaaatgttcgtttcagcggcgca
caagctgaaggttgttcacccatcgcccaagcatttagagaagaccgcgacttcattaaa
cctgtgaaaccaaatacaattgctaaatcgatcgcaattggcaatccagcggatggtgta
tatgctgtcgaaattgcgaagaagacaggcggtaatatagaatcagtcaccgatgcagaa
attattgaaggcatcaagctgctggcagaaactgaaggtatctttacagaaacagctggc
ggtacaactgtagctgtgctgaaaaaattggtagaagctggcaaaattgatccaaatgaa
actaccgtagtttacatcactggtaatggtttgaaaacccaagaagcaattcaaggttac
gttggcgaaccgttgacaattgatgctaaactcgatagctttgaacgtgcgctagaacgc
tctcgcactcttgaccgcttagaatggcaacaagttctagtttaa

DBGET integrated database retrieval system