KEGG   Nostoc sp. PCC 7107: Nos7107_0535Help
Entry
Nos7107_0535      CDS       T02362                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00010  Glycolysis / Gluconeogenesis
nos00052  Galactose metabolism
nos00500  Starch and sucrose metabolism
nos00520  Amino sugar and nucleotide sugar metabolism
nos00521  Streptomycin biosynthesis
nos01100  Metabolic pathways
nos01110  Biosynthesis of secondary metabolites
nos01120  Microbial metabolism in diverse environments
nos01130  Biosynthesis of antibiotics
nos01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nos00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nos7107_0535
   00052 Galactose metabolism
    Nos7107_0535
   00500 Starch and sucrose metabolism
    Nos7107_0535
   00520 Amino sugar and nucleotide sugar metabolism
    Nos7107_0535
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nos7107_0535
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Nos7107_0535
Enzymes [BR:nos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Nos7107_0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AFY41208
UniProt: K9Q790
Position
626841..627866
Genome map
AA seq 341 aa AA seqDB search
MTLLLAGDIGGTKTILRLVETSETQDLQTIYEDSYRSGDFPDLVPMVQQFLLKANTGIPQ
KACFAIAGPVVNNTAKLTNLAWYLDTERLQQELSIAAISLINDFAAVGYGIFGLSAEDLL
TLQPGKQKLAAPIAVIGAGTGLGQGFLMKQGDNYQVFPSEGGHADFAPRNELEFQLMKYL
LDKHDIQRVSVERVVSGLGIVAIYQFLRDRKHATESPEIAQAVRTWEQEAGQPEKSVDPG
AVIGKAAVQKSDRLSEQTLQLFVDAYGAEAGNLALKLLPYGGLYIAGGIAPKILPLIQNG
NFLLNFTQKGRMRSLLADVPVYIILNPQVGLIGAALCAARL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgactttgttactagcaggagatatcggtggcacaaaaaccattttgcgattagtggaa
acatcagaaacacaagatttacagactatttatgaggacagttatcgtagtggggatttt
cctgatttagtgccgatggtacagcagtttttacttaaagcaaatacaggaattcctcaa
aaagcttgttttgcgatcgctgggccagtagtcaataacacagcaaaattaactaacctt
gcatggtatttagataccgaacgtctgcaacaagaattaagtattgcggcaatttcgctg
attaatgactttgcggctgtgggctatggaattttcggtttaagtgcagaagatttactg
actttacaaccagggaaacagaaactagcagcacctatcgcggtgattggtgcaggtact
ggattaggacaaggctttttgatgaagcagggagataattatcaagtttttccttctgaa
ggtggtcacgccgactttgcccctcgcaatgagttagaatttcagctgatgaaatatttg
ctggataaacatgatatccagcgtgtttctgtagaacgcgttgtatccgggttgggtatt
gtggcgatttaccaatttctgcgcgaccgcaaacatgcgacggaatccccagaaatcgcc
caagctgtgagaacttgggaacaagaagccggacagccagaaaaaagtgttgatcctggt
gcggtgattggtaaagccgcagtgcagaaaagcgatcgcctctcggaacaaactctacag
ttatttgttgatgcttacggtgcagaagctggaaatctcgccttgaaacttttgccttac
ggtggtttgtacatcgctggtggaattgccccaaaaattctacctttaattcaaaacggt
aatttcttattgaacttcacgcaaaaaggccgaatgcgttctcttttggcagatgtacca
gtatatattattctcaacccccaagtaggattaataggtgcagctttgtgtgcagctagg
ttataa

DBGET integrated database retrieval system