KEGG   Nostoc sp. PCC 7107: Nos7107_1404Help
Entry
Nos7107_1404      CDS       T02362                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
nos  Nostoc sp. PCC 7107
Brite
Enzymes [BR:nos01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Nos7107_1404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AFY42047
UniProt: K9QB47
Position
complement(1627771..1628469)
Genome map
AA seq 232 aa AA seqDB search
MIELYYWTTPNGHKITIFLEEAELPYKIVPINIGAGEQFQPDFLKISPNNRIPAIVDHEP
AGGGAPVSVFESGAILLYLAEKTGKLIPPDIRKRVEVLQWLFWQMGGLGPMAGQNHHFST
YAPEKIEYAINRYVNETARLYAVLNKQLADKEFIAGDYSIADIAAYPWIVPYERQSQKLA
DFPNIQRWFEAIKARPATIRAYEKAEAFKNQALDIDKSRNLLFNQSAKTVTN
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgattgagctttactattggacaacgcccaacggtcataaaatcacgatatttctggaa
gaagcggaattaccttacaaaattgtgcctatcaatataggtgctggggagcagtttcaa
ccagactttctcaagatttctcctaacaatcgtatcccggcgatcgttgaccatgaacca
gccggtgggggtgcgccagtttcagtatttgaatcaggggcaattttgctttatttagcc
gaaaaaaccgggaaattaattcctccagatattagaaaacgagtagaagtactgcaatgg
ctgttttggcaaatggggggtttggggccaatggccggacagaatcaccactttagtacc
tacgctcccgaaaaaattgaatatgcaattaaccgctatgtcaacgaaacagcacgctta
tatgcagtgctaaataagcaactagcagataaagaattcattgctggtgattattccatt
gcagatatcgccgcttatccttggattgtgccttatgaacgccaaagtcaaaaattagca
gattttcccaatatccaacgctggtttgaagcaattaaagctcgtcctgcaacaattcgt
gcctacgagaaagccgaagcattcaaaaatcaagctttagatatcgacaaatcacgaaat
ttgttgttcaaccaatcagcaaagacagttacaaattaa

DBGET integrated database retrieval system