KEGG   Nostoc sp. PCC 7107: Nos7107_1417Help
Entry
Nos7107_1417      CDS       T02362                                 

Definition
(GenBank) ferredoxin protochlorophyllide reductase subunit L
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00860  Porphyrin and chlorophyll metabolism
nos01100  Metabolic pathways
nos01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nos00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Nos7107_1417
Enzymes [BR:nos01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Nos7107_1417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MipZ MeaB AAA_24 AAA_25 AAA_26 SRP54
Motif
Other DBs
NCBI-ProteinID: AFY42060
UniProt: K9Q8S7
Position
1642217..1643083
Genome map
AA seq 288 aa AA seqDB search
MKLAVYGKGGIGKSTTSCNISVALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQS
KDYHYEDVWPEDVIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVIL
FDVLGDVVCGGFAAPLNYADYCMIVTDNGFDALFAANRIAASVREKARTHPLRLAGLIGN
RTSKRDLIEKYIEAVPMPVLEVLPLIEDIRVSRVKGKTLFEMAESDPSLNYVCEYYLNIA
DQILARPEGVVPNDTPDRELFSLLSDFYLNPRKPQVPNQEEELDLMIV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactagcagtctacggaaaaggcggtattggcaagtcaacaactagctgtaacata
tctgtcgctttagccaaacggggtaaaaaagtactgcaaattggttgcgaccccaaacac
gacagcacttttaccctaacagggtttttgattcctacaattattgatactcttcagtcc
aaagactatcactacgaagacgtttggccagaggatgtcatttacaaaggctatggcggt
gttgattgcgtagaagctggcggcccacctgcgggtgctgggtgtggtggatacgtagtt
ggcgagaccgtaaaattactgaaagaactcaacgcctttgatgagtatgacgtaatttta
tttgatgtactaggtgacgtagtttgtggtggttttgcggctcctttgaactatgcagat
tattgcatgatcgttacagataacggctttgatgctttatttgctgcgaatcggattgct
gcttccgtcagagaaaaagcccggactcacccactgcgtttagcaggattaattggcaat
cggacttccaaacgtgacttgatcgagaaatacatagaagcagtccccatgccagttcta
gaggttttaccattaattgaagatattcgcgtatctcgcgttaaaggcaaaacattattt
gaaatggcagagtcagatccttccctgaactacgtttgcgagtattacctcaacattgcc
gaccaaattttagccaggccagagggagtagtcccaaatgatacaccggatcgggaattg
ttctctttgttatccgatttttatctaaatccgcgtaaaccacaggttcctaatcaagaa
gaggaattagacttgatgattgtataa

DBGET integrated database retrieval system