KEGG   Nostoc sp. PCC 7107: Nos7107_1841Help
Entry
Nos7107_1841      CDS       T02362                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00630  Glyoxylate and dicarboxylate metabolism
nos00710  Carbon fixation in photosynthetic organisms
nos01100  Metabolic pathways
nos01110  Biosynthesis of secondary metabolites
nos01120  Microbial metabolism in diverse environments
nos01130  Biosynthesis of antibiotics
nos01200  Carbon metabolism
Module
nos_M00165  Reductive pentose phosphate cycle (Calvin cycle)
nos_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
nos_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:nos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Nos7107_1841
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nos7107_1841
Enzymes [BR:nos01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Nos7107_1841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AFY42473
UniProt: K9QAT6
Position
complement(2118653..2118982)
Genome map
AA seq 109 aa AA seqDB search
MQTLPKERRYETLSYLPPLSDVQIEKQVQYILSQGYIPGVEFNEVSEPTEFYWTMWKLPL
FGAKTSREVLAEVQSCRSQYPTHYIRVVGFDNIKQCQVLSFIVHKPNRY
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccctaccaaaagagcgtcgttacgaaaccctttcttacttacctcctctttct
gacgttcaaattgagaagcaagtccaatacattttgagccaaggctacattccaggtgtt
gagttcaacgaagtttctgaacccaccgaattttactggacaatgtggaagttgccttta
ttcggcgctaaaacatctcgtgaagtattggctgaggttcaatcctgccgttctcaatat
cccacacactacatccgtgttgtaggttttgacaacattaagcagtgtcaagttctcagc
ttcattgttcacaaacccaacagatattga

DBGET integrated database retrieval system