KEGG   Nostoc sp. PCC 7107: Nos7107_2611Help
Entry
Nos7107_2611      CDS       T02362                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos03010  Ribosome
Brite
KEGG Orthology (KO) [BR:nos00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Nos7107_2611
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nos03011]
    Nos7107_2611
Ribosome [BR:nos03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Nos7107_2611
  Bacteria
    Nos7107_2611
  Archaea
    Nos7107_2611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AFY43212
UniProt: K9QEG9
Position
complement(3030887..3031246)
Genome map
AA seq 119 aa AA seqDB search
MATNTTEVKAIARYIRMSPFKVRRVLDQIRGRSYREALIILEFMPYRACDPVLKLIRSAA
ANAEHNAGLDRAQLVITQAYADQGPVLKRFQPRAQGRAYQIRKPTCHITVAVAAGDTAE
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggcaactaatactacagaagtaaaagcgatcgcccgttatatacgtatgtctcccttt
aaggtgcgtcgtgtacttgatcaaattcgagggcggtcttatagagaagcgctcataatc
ctggaattcatgccttatcgggcttgtgacccagtactgaaattgatcagaagcgcagcc
gcaaatgctgaacataatgcaggtctagaccgcgctcaactggtgattacccaagcttac
gctgatcaaggcccagtcctgaaacgtttccaacctagagcgcaaggtcgagcttaccaa
attcgcaaacctacgtgtcacattacagtagctgttgctgctggcgatactgcggaataa

DBGET integrated database retrieval system