KEGG   Nostoc sp. PCC 7107: Nos7107_4145Help
Entry
Nos7107_4145      CDS       T02362                                 

Definition
(GenBank) glycoside hydrolase family 3 domain protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00520  Amino sugar and nucleotide sugar metabolism
nos01100  Metabolic pathways
nos01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:nos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Nos7107_4145
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Nos7107_4145
Enzymes [BR:nos01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Nos7107_4145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Novirhabdo_Nv
Motif
Other DBs
NCBI-ProteinID: AFY44696
UniProt: K9QHP7
Position
4843670..4844758
Genome map
AA seq 362 aa AA seqDB search
MPVSRELELFGNHVILGVSGTKLSDDDKRALSELKPVGVIFFAKNFIDGVPYQVWLASFQ
ELIDQIREYAERDSMFMTLDHEGGRVVRTPLPITRFPYAALLRSQAKEVAKATARELKSL
GINVSWSPVADVYSNPHNPIIGPRAFGNTPETAAQGALAYYLGLQESGILGCAKHFPGHG
DTSTDSHFELPVLNLTVQDLRDRELIPFKALIDAQVPLIMTTHILFPQIDPDVPATISQR
ILKNILRDELGFEGVVVSDDLDMKAVSDRFTQSGTVARAFNAGCDLFILSRNINSSSLER
TYYMAGDFADALSNGNLKKEVVTAASQRIENLLAQTPQYIVHALDKATLLQHAELAIACS
FS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgccagtatcacgggagctagaactattcggaaatcatgtaattctaggtgtttccggc
acaaaattaagtgatgatgataaacgggcgctcagtgaattaaaaccagttggggtgata
ttttttgcgaaaaactttatagatggtgttccttatcaggtttggttagccagctttcaa
gaactcatagaccaaattcgtgaatatgcggaacgtgattcaatgttcatgacgttagat
catgaaggtgggcgtgtagtccgtacacccttaccaattacgagatttccttatgctgcg
ttgttgcgatcgcaagctaaagaagtagcaaaggccacagcacgagagttgaaatcactg
ggaattaacgtatcttggtcgcctgttgctgatgtttattctaatccgcataacccgata
attgggccgcgtgcctttggtaacacgccggaaacagcagcacaaggagcgttggcatat
tatttagggctacaagagtctggtattttaggatgtgccaagcattttccgggacatgga
gacaccagtacagattctcattttgagttaccagtactaaatttaactgtacaagatttg
cgcgatcgcgaactgatacctttcaaagctttgattgatgctcaagttcctttaattatg
acaactcacattttatttccccaaattgacccagatgtcccggcgactatttcgcaacgg
attttgaaaaatatccttcgggatgaactagggtttgagggtgtagttgtctctgatgac
ttggatatgaaagcagtttccgataggtttacccaaagtggaaccgtcgcccgcgctttt
aacgctgggtgtgacttgtttattctctcgcggaatatcaactcatcgtctttggaacgc
acttattacatggcgggggattttgctgatgcgctcagtaacggtaacttaaagaaagag
gtagttacagctgctagtcagagaattgaaaatttactagcacagacaccccaatatatt
gtccatgctttagataaagctacattactacaacacgcggagttagcgatcgcttgttct
ttctcataa

DBGET integrated database retrieval system