KEGG   Nostoc sp. PCC 7107: Nos7107_5324Help
Entry
Nos7107_5324      CDS       T02362                                 

Definition
(GenBank) Photosystem Q(B) protein
  KO
K02703  photosystem II P680 reaction center D1 protein [EC:1.10.3.9]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00195  Photosynthesis
nos01100  Metabolic pathways
Module
nos_M00161  Photosystem II
nos_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:nos00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    Nos7107_5324
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:nos00194]
    Nos7107_5324
Enzymes [BR:nos01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.9  photosystem II
     Nos7107_5324
Photosynthesis proteins [BR:nos00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Main subunits
    Nos7107_5324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Photo_RC
Motif
Other DBs
NCBI-ProteinID: AFY45809
UniProt: K9QL42
Position
complement(6180050..6181132)
Genome map
AA seq 360 aa AA seqDB search
MTTTLQQRSNANVWERFCEWITSTENRIYVGWFGVLMIPTLLAATTCFVIAFIAAPPVDI
DGIREPVAGSLIYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVIFHFL
IGCACYMGRQWELSYRLGMRPWICVAYSAPLASATAVFLIYPIGQGSFSDGMPLGISGTF
NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNYGYKFG
QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF
NFNQSVIDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAGEVKPVAMSAPAING
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaaccttacaacagcgttctaacgctaacgtatgggagcgcttctgcgagtgg
atcaccagcaccgaaaaccgcatttatgttggttggtttggtgtactaatgatccctaca
ttgctggctgcaaccacctgctttgtaatcgctttcatcgctgctcctccagtagacatc
gatggtatccgtgaacctgttgcaggttccttgatctacggaaacaacatcatctctggt
gcagttgttccttcctccaatgcgattggcttgcacttctacccaatctgggaagctgct
tccttagatgagtggttgtacaacggtggcccataccaactagtaattttccacttcctc
atcggatgtgcttgctacatgggtcgtcagtgggaactatcctaccgcttaggtatgcgt
ccttggatctgcgtagcttactccgcgcctttggcttctgctaccgcagtattcttgatc
tacccaatcggacaaggttccttctctgatggtatgcccttgggtatctctggaacattc
aacttcatgattgtgttccaagcagaacacaacatcttgatgcaccccttccacatgctg
ggtgtagcaggtgtatttggcggttccttgttctctgcgatgcacggttcattggtaact
tcctctttggttcgtgaaacaaccgaaactgaatctcaaaactacggttacaaattcggt
caagaagaagaaacctacaacatcgttgcagcacacggttacttcggtcgcttgatcttc
caatacgcatccttcaacaacagccgttccttgcacttcttcttagctgcatggcctgta
gtcggtatctggttcacagcactaggtatcagcacaatggccttcaacttgaacggtttc
aacttcaaccaatcagtgattgactctcaaggtcgcgtcatcaacacctgggctgatatc
atcaaccgcgctaacttgggtatggaagtaatgcacgagcgtaacgctcacaacttcccc
ctagacttagctgctggtgaagttaaacctgttgcaatgagcgctcctgctattaacggt
taa

DBGET integrated database retrieval system