KEGG   Nostoc sp. PCC 7107: Nos7107_5330Help
Entry
Nos7107_5330      CDS       T02362                                 

Definition
(GenBank) hypothetical protein
Organism
nos  Nostoc sp. PCC 7107
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4090
Motif
Other DBs
NCBI-ProteinID: AFY45815
UniProt: K9QJK0
Position
6190368..6190673
Genome map
AA seq 101 aa AA seqDB search
MTAETNQVNSPTTGADAIDVAIAKGIDFDGTPIPTAKLDLYHQVMGLEANRQRSGVSNTM
RSRIVRIGAKHIPQPELDQKLTEAGFAPLKEKEIAFFYGGK
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgactgccgaaactaatcaagtaaattccccaaccacaggtgcagatgcaattgacgta
gcgatcgccaaagggatagattttgatggaacacccattcccaccgccaaactagacctt
tatcaccaagtcatggggctagaagctaatagacagcgtagtggcgtgtcaaataccatg
cgatcgcgcattgtcagaatcggtgcaaaacatattccccaaccagaactcgatcaaaag
cttacagaagcgggatttgcacctctcaaagaaaaagaaattgcttttttctacggtggt
aaataa

DBGET integrated database retrieval system