KEGG   Nostoc sp. PCC 7107: Nos7107_5343Help
Entry
Nos7107_5343      CDS       T02362                                 

Definition
(GenBank) protein of unknown function DUF1486
Organism
nos  Nostoc sp. PCC 7107
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SnoaL SnoaL_2 DUF4440
Motif
Other DBs
NCBI-ProteinID: AFY45828
UniProt: K9QKC8
Position
6201024..6201518
Genome map
AA seq 164 aa AA seqDB search
MCREISLTEQNKDIVLQFYRAFDNRNISQALALLSPNFVAHMAGIPTPLDTEGFKKFGMA
FYLAFTNGQHTFDQVLIEGDKVVTCGTFTATHLGEFQGLPPTGKQIKLSIMHIDRIENGK
IVEHWGQGDAFGLMQQLGIIFFPGPTLFPHIIKSLLSKPFKKPT
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgtgtagagaaataagtctaactgaacaaaataaagatatcgttcttcagttctataga
gcatttgataatcggaatattagtcaggcgttggcacttctatcccccaattttgttgct
cacatggctggcatacctactcctcttgacactgaaggttttaaaaagttcggtatggct
ttctacttagcctttacgaacggtcaacatacatttgaccaagtgcttattgaaggagat
aaagtcgttacttgcggaacattcacagctacacatcttggagagttccaaggtcttcct
ccaacaggtaagcaaattaagttatcaatcatgcacattgatcgcattgaaaacggcaaa
attgtagaacattgggggcaaggcgatgcctttgggttaatgcaacagttaggcattatt
ttttttccagggcctacactttttccgcatattattaaaagtctcttatccaagccgttt
aagaagccaacataa

DBGET integrated database retrieval system