KEGG   Nostoc sp. PCC 7107: Nos7107_5345Help
Entry
Nos7107_5345      CDS       T02362                                 

Definition
(GenBank) membrane protein of unknown function
  KO
K08972  putative membrane protein
Organism
nos  Nostoc sp. PCC 7107
Brite
KEGG Orthology (KO) [BR:nos00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Nos7107_5345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_holin_4_2 Transgly_assoc
Motif
Other DBs
NCBI-ProteinID: AFY45830
UniProt: K9QJM7
Position
6202728..6203081
Genome map
AA seq 117 aa AA seqDB search
MKHFLLTWLATAVALLITSRIVDGFIVNNFVAALVAVFIIGLVNAFVRPILRLLAFPITL
LTFGLFTFVINALSLWLASAITPGTGFEIRGFLPALLGSIVLSIVSSVINYFLRAVE
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgaaacactttttgttaacttggttagctactgcggtggctttactgattacctctaga
attgtggatggttttattgtcaataattttgttgctgctttggttgcggtatttattatt
ggattagttaatgcttttgtcaggccaattttgcggcttttggcatttcccattacctta
ctgacttttggtttatttacatttgtcattaatgctttatctctgtggttagccagtgct
atcactccaggtactggttttgagattagaggctttttacccgctttgcttgggtctatt
gtgctatcaattgtgtcgagtgtgattaattattttctcagagcggttgaatag

DBGET integrated database retrieval system