KEGG   Nostoc sp. PCC 7107: Nos7107_5346Help
Entry
Nos7107_5346      CDS       T02362                                 

Definition
(GenBank) cobalamin (vitamin B12) biosynthesis CbiG protein
Organism
nos  Nostoc sp. PCC 7107
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiG_C
Motif
Other DBs
NCBI-ProteinID: AFY45831
UniProt: K9QL04
Position
complement(6203098..6203559)
Genome map
AA seq 153 aa AA seqDB search
MLTNLNTTSNTKDSHYCRNLWVGIGFQRGSSPQLLAIAIEEVFQKNILDERAIAGIATID
TKASDIALGELCQLHNWLLQTFSAEKLATVAVPNPSAIITKTTGTPSVAEAAAILAAAKN
TQLGTKLLVPKNIFRLSALPGVVTVAVAEEMQP
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
ttgctgactaacttaaatacaacatccaacacaaaagattctcactactgccgaaattta
tgggtggggattgggtttcaacgaggtagttcaccacagttgcttgcaatagctattgaa
gaagtatttcaaaaaaatatcctcgacgaaagagcgatcgccggaattgctaccatcgat
acaaaggcatcagatattgctttaggagaactttgtcaactccacaattggctgttgcaa
acattttccgcagaaaagttagctactgttgcagttcccaacccatctgcaatcatcacc
aaaacaacgggaacacccagtgttgcagaagctgcggcgattttggcagcagctaaaaat
acccaactgggtactaagttattggttcctaaaaatattttccgcttatcagcactacct
ggggtagtaactgtagcggtagctgaagaaatgcagccgtga

DBGET integrated database retrieval system