KEGG   Nostoc sp. PCC 7107: Nos7107_5349Help
Entry
Nos7107_5349      CDS       T02362                                 

Definition
(GenBank) DNA mismatch repair protein MutS
  KO
K03555  DNA mismatch repair protein MutS
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:nos00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    Nos7107_5349
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nos03400]
    Nos7107_5349
DNA repair and recombination proteins [BR:nos03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    Mismatch and loop recognition factors
     Nos7107_5349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MutS_V MutS_III MutS_I MutS_IV MutS_II
Motif
Other DBs
NCBI-ProteinID: AFY45834
UniProt: K9QL95
Position
6205975..6208542
Genome map
AA seq 855 aa AA seqDB search
MTASDSDNQPTESHQPPAPHADTRLVDRSKLSKMYQHYVEVKDQHPHALLLYRVGDFFET
FFQDAVTVSRELELVLTSKHGGEAGRVAMTGVPHHAWERYTTLLVEKGYAVVICDQVEDA
SEAVGLVRREVTRILTPGTLLEEGMLKSSRNNYLAAVVIAATHWGLAYADISTGEFLTTQ
GSDLEHLTQELMRLQPSEVLVPTNAPDLGVLLRPGETSPHLPQCLPPSFCYSLRSQVPFS
QGEARSKLLQKFKVRSLEGLGCDHLPLAVRAAGGLLEYVEDTQKENTVSLQRLRTYTLTD
YLIIDHQTRRNLEITQTVRDGTFHGSLLWALDRTSTAMGSRALRRWLLQPLLDLKGIRSR
QDTIQELKENTPLRQDLRYLLRQIYDLERLTGRASSGTANARDLIALADSLSRLPELARV
VADAGSPFLKALQKVPPVLEELAQQIQAHVVEAPPIHLKEGGLIRPGINVLLDERKATVE
ADHQWIANLEVDERTRTGIPTLKVGFNETFGYYISISRTKADQVPANYIRKQTLKNEERY
ITPELKEREARILSARDDLYKLEYEIFVALREEVGEQAEAIRQLSRAVAAADVLCGLAEL
AVQQGYFRPEMISGRELEIVDGRHPVVEQSLPAGFFVPNSTNLGSGEATAFPDLIILTGP
NASGKSCYLRQVGLIQLMAQIGSFVPVKSAKLGICDRIFTRVGAVDDLATGQSTFMVEMN
ETANILNHATSRSLVLLDEIGRGTATFDGLSIAWAVAEYLGMEIRSRTIFATHYHELNEL
ASMLPNVANYQVTVKELPDQIIFLHQVQPGGADKSYGIEAGRLAGLPAVVIQRAKQVMGQ
IEKHSKIAIGLKNLT
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcttctgactctgacaaccagccaacggaatctcatcaaccccctgcgcctcac
gcggatacgcgattggtagatcgcagtaagctgagtaaaatgtatcagcattatgtggaa
gttaaagatcagcatcctcatgcgctgttgctgtatcgggtaggggatttctttgaaact
tttttccaagatgcggtgactgtttcgcgggaactggaattagttctcactagcaagcac
ggcggggaagcaggacgagtcgccatgactggtgtaccgcaccacgcttgggaacgctac
actaccttattggtggaaaaaggttatgcagttgttatttgcgaccaagtagaagatgct
tcggaagcggtaggtttggtgcgccgggaagtaacgcgcatcctcacccctggtactttg
ttagaagagggaatgttaaagtctagccgcaataattatttagcagcggttgttattgct
gctactcattggggtttagcttatgcagatatctccactggggaatttctgacaactcaa
ggtagcgatttagaacacctcacccaagaattaatgcgcctccaaccttccgaggtgctg
gttcccaccaatgcgcctgatttgggtgtgttgctgcgtcctggggaaacttcgccccat
cttccccaatgtttaccaccatcattttgttatagtttgcgatcgcaagtacctttttct
caaggggaagccagaagtaaattattgcagaaatttaaggtgcgatcgctcgaaggtttg
ggttgtgaccatcttcctctggctgtacgggcggcgggcggtcttttagaatatgtggaa
gatacccaaaaagaaaacactgtttctctgcaaagactccgcacctacaccctcacagac
tatttaattattgaccatcaaacccggcggaatttagaaattacccaaacagtccgcgat
gggacttttcacggttccctactttgggcgttagatagaactagcaccgcaatgggaagt
cgggctttacggcgttggttattacaaccgctacttgatcttaaaggcatccgatcgcgg
caagatacaattcaagaattaaaagaaaatacacctctacgtcaagatttgcgctattta
ttacggcaaatctacgatttagaacgcctcacaggacgggcgagttctggtacagccaat
gcacgagatttaattgctttagctgattctctctcccgtttacccgaattagcccgtgta
gtcgctgatgcgggttctccttttttgaaggctttgcaaaaagtcccgcctgtattagaa
gaattagcgcaacaaattcaagcccatgtcgtcgaagcaccacccatacatttaaaagaa
ggtgggttaattcgtccgggaattaatgtactgttggatgaaagaaaggcgactgtagaa
gcagaccatcaatggattgcgaatttagaagttgatgaaaggacgagaacgggaatcccg
actttgaaggtgggatttaacgaaacctttggttactacattagtatttcccgcaccaaa
gccgatcaagtacccgctaactatatccgcaagcaaaccctcaagaatgaggaacgttac
atcactccagaactgaaggaacgagaagcaaggattctcagtgcgcgggatgatttatat
aagttggaatatgaaatttttgtggcgttgcgcgaagaagtcggcgaacaagccgaggct
attcgtcaactttctcgcgctgtggcggcggcggatgtgttgtgtggtttagctgagttg
gcggtacaacaaggttattttcgtcccgaaatgatatcagggcgagaactagaaattgta
gatggtcgccatcccgtggtagaacaatctttaccagcgggtttctttgtgccgaattcg
actaatttaggaagtggtgaagcaactgcattccccgacttaatcattcttaccgggcca
aacgccagtggtaaaagttgttatttgcgtcaggtagggttaattcagttaatggcgcaa
attggcagttttgtccccgtgaagtcggcaaagttgggaatatgcgatcgcatttttacc
cgtgtcggtgcggtggatgatttagcaactggtcaatctacctttatggtggaaatgaat
gaaacagccaatattctcaaccatgctacatctcggtcgttagtcttattagatgaaatt
gggcgcggaacagcaacatttgatggtctttccattgcttgggcggtagcagaatattta
ggaatggagattcgttcacgaacaatttttgccactcattaccacgaactaaacgaattg
gcaagcatgttacctaatgttgccaattatcaagtgacagtgaaagaattacccgaccaa
attatctttttacaccaagttcaacccggtggtgctgataaatcctacggtattgaagcg
ggaagattagcaggtttaccagcagtagtaattcaacgggcaaaacaagtcatggggcaa
attgagaaacacagtaagattgcgatcggtttgaaaaatttgacgtaa

DBGET integrated database retrieval system