KEGG   Nostoc sp. PCC 7107: Nos7107_5352Help
Entry
Nos7107_5352      CDS       T02362                                 

Definition
(GenBank) Terpene synthase metal-binding domain-containing protein
  KO
K18109  5-epi-alpha-selinene synthase [EC:4.2.3.90]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:nos00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    Nos7107_5352
Enzymes [BR:nos01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.90  5-epi-alpha-selinene synthase
     Nos7107_5352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Terpene_synth_C DUF5106
Motif
Other DBs
NCBI-ProteinID: AFY45837
UniProt: K9QM26
Position
6212524..6213492
Genome map
AA seq 322 aa AA seqDB search
MEKLSFPDLYCPFPSQVNKYVDVLEDYSLEWLYHFDLLANESIYQNFSKSKFFLLAAGTY
PYCELEDIKITSDWHTWLFIWDDQCDMSDLGTKPEVLNMYHKRFLEILCGAKPNNQDISL
SFALRDLRQRILQRGNEKWFDYFVRCCQDYFYGCVLQAEYRAQRIVPSVNTYIMIRNLCS
AVDSCLALIEIGYQMNVFGSIRENHLIKQLNVITNNIISWCNDIFSAPREIGSRDVHNLV
FVLHHQHRINLTQAIIIAAEMHDQKVRELINLEASLPSFDQKVDQEVTEYISGLHSWIRG
NLDWYFQSDRYQSLESLELSQI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagttaagttttcccgatttatactgcccatttccatctcaagttaataagtat
gtagatgttttagaagattattcattggaatggttatatcactttgatttactagcaaat
gaatcaatttatcaaaatttttcaaaatcaaagttttttttattagccgcaggtacttat
ccctactgtgaacttgaagatatcaaaattacaagtgattggcatacttggctatttatc
tgggatgatcaatgtgatatgtctgatctaggcacaaaacctgaagttttaaacatgtat
cacaaaagatttctggagatattatgtggagcaaaaccaaacaatcaagatatatcttta
agctttgctttaagagatttaaggcaaagaatcttgcaaagaggaaatgagaagtggttt
gattattttgttcgttgctgtcaagattacttttacggatgcgttctacaggcagaatat
cgcgctcaaaggattgtacctagtgttaacacatatatcatgatccgtaatttatgttca
gcagtagatagttgtctcgcattaattgaaattggatatcaaatgaatgtttttggttcc
atcagagaaaatcaccttattaagcaacttaatgtcataactaataatatcatttcctgg
tgtaacgatattttctctgctcctagagaaataggtagtagagatgttcataatttagta
tttgtactacaccatcaacatcgaataaatctaactcaagcaattataattgcagcagaa
atgcacgatcaaaaggtaagagaattaattaatttagaagcctctctgccatcatttgat
caaaaagttgatcaggaagttacagaatacatatcaggattacattcatggatacgaggg
aacctagattggtattttcaatctgatcggtatcagagtttagaatcacttgaattatct
caaatctga

DBGET integrated database retrieval system