KEGG   Nostoc sp. PCC 7107: Nos7107_5353Help
Entry
Nos7107_5353      CDS       T02362                                 

Definition
(GenBank) Unspecific monooxygenase
Organism
nos  Nostoc sp. PCC 7107
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-ProteinID: AFY45838
UniProt: K9QKF2
Position
6213579..6214970
Genome map
AA seq 463 aa AA seqDB search
MPLPNLIQTPSFIQKLQWIVDPVHYMESAAKKYPDIFTANIVGFGCPVVFVNHPKAIQEI
FTNDRKKFAALGEANSIFQPLIGNTSTIMLDGDRHKQRRQLLMPPFHGERMQAYGSLICD
LTEKVFSELPLNKSFSARTVVQEVSLLIILEAVFGLHKGERYYQLRRLLALLMDVFKSPL
TSSFLLLPFLQKNLGDWSPWGKFLRQRQQIDQLLYTEIAERREQADPNRIDILSLLMSAR
DEAGNAMTDQELRDELMTLLLAGHETASTAMAWALYWIHYQPEVRAKLLQELATLGNKPD
PTSIFRLPYLTNVINETLRMYPVLMATLPRVVQEPAELLGHPIEPGTVLVGGIYLTHHRE
NLYAEPDKFQPDRFLNYQFSPYEYMPFGAGVRRCMGEALALFEMKLVLATILSGYQLELE
SQQPEKAQRRSVTLGPANGVKMVIKGRRVRQRSQVPTATAPTH
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgccattaccaaatcttattcagactccttcttttattcaaaagcttcaatggatagtt
gatcctgttcactacatggaaagtgcagccaaaaaatatcctgatattttcactgctaat
atagtgggttttggttgtccagtagtatttgtaaaccatcccaaagcaattcaggaaatt
tttaccaatgatagaaagaagtttgctgcgcttggcgaagcaaacagtatttttcaaccc
ttaattggtaatacttcaacaattatgttagatggcgatcgccacaaacaacggcgacaa
ttgttgatgcctccatttcacggagaaagaatgcaagcttatggttctttaatttgtgat
cttactgaaaaagtatttagtgagttacccctaaacaaatctttttccgctcgtactgta
gtacaagaagtgtcactgttaatcatcttagaagctgtttttggtttacataagggagaa
cgttactatcaactccggcgtttattagcgttattgatggatgtctttaagtcaccactt
acatctagctttcttttattaccatttttgcaaaaaaatttaggtgactggagtccttgg
ggcaagtttctgcgccaacgccaacagattgatcaattgctttacactgaaattgctgaa
cgtcgggaacaggctgatccaaatcgcattgacattctttcgttattgatgtcagctagg
gatgaagcaggtaatgcaatgactgatcaggagttgcgtgatgagttaatgactctgcta
ttggcaggccatgaaacggcttcaacagctatggcttgggcattatattggattcattac
caaccagaagttcgggcaaaattactgcaagaacttgctaccttgggtaataaaccagac
cctacgagtattttccggctaccttatcttacaaatgtcatcaatgaaactctgcgaatg
taccctgttttgatggcaactttacctagagtggtgcaggaacccgctgaattgctggga
catcctatagaacctggtacggtactggttggtggcatttatcttactcatcaccgtgag
aatttatatgcagagccagataagtttcagccagatagatttctcaattaccaattttct
ccttatgaatatatgccttttggtgccggtgttcgtcgctgcatgggtgaagcgttggca
ctgtttgagatgaaattagtattagcaaccattttatctggctatcaactggaattagaa
agtcaacaaccagagaaagctcaacgccgaagcgttacccttgggccagccaatggagtc
aagatggtaattaaagggcggcgtgtgcgccaaaggtctcaagtacctacagcaactgca
ccaacccattaa

DBGET integrated database retrieval system