KEGG   Nostoc sp. PCC 7107: Nos7107_5360Help
Entry
Nos7107_5360      CDS       T02362                                 

Definition
(GenBank) protein of unknown function DUF1092
Organism
nos  Nostoc sp. PCC 7107
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1092
Motif
Other DBs
NCBI-ProteinID: AFY45845
UniProt: K9QJR0
Position
6230856..6231653
Genome map
AA seq 265 aa AA seqDB search
MKIWQADFYRSSQQDKSGQVLWELLICDVNRSFEYTAACPQSEANSSWVIEQIQQAAGEK
LPNVIQVFRPQSLSLIETAGRNLGIVVEATRRTLALKQWLQERHSAVSLEKPAPLPLPEN
LWGEQWRLATLAAGDLETEFSDRPIPILSMPEFLTPINLGLASTIPVPGVVIYGGRQSMR
LARWLATAKPVALNYIAGAPDGLILEAGLVDRWVLATFEDAEVTTAAKIYEQRKQQSRGL
HFLLIQPDDSGMTYSGFWLLQSEIN
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttggcaagctgatttttatcggagttcacaacaagataaatctggacaagtg
ttgtgggagttgttgatttgtgatgtaaatcgcagctttgagtatacagcagcctgtccc
cagtcagaggcaaattcaagctgggttattgaacaaattcaacaagcagcaggtgaaaaa
ttaccaaatgtgattcaagtttttcggccgcagtcgttaagtttaattgaaacagccgga
cgcaacttaggtattgtggtagaagcaacccgccggactttagcactcaaacagtggtta
caagaaaggcattctgctgttagtttagaaaaacctgcacctttaccattaccagaaaat
ctttggggtgaacagtggcgcttggcaactttagcggctggcgacttagaaacggaattt
agcgatcgccccattcccattttatctatgccagaatttcttacacccataaatctgggt
ttggcctcaacaatacctgttcctggtgtagtaatttatggcggtaggcaatctatgcgt
ttggcacgttggttagccacagctaaacctgtagctttaaattacatagctggtgcgccc
gatggtttaattttagaagctggtttggttgatagatgggtattagccacttttgaagat
gctgaagtcaccaccgctgccaaaatttatgaacagcgtaaacaacaaagtcgaggatta
cactttttgttaattcaacccgatgattctgggatgacttacagcggcttttggttatta
caaagcgaaattaattga

DBGET integrated database retrieval system