KEGG   Nostoc sp. PCC 7107: Nos7107_5374Help
Entry
Nos7107_5374      CDS       T02362                                 

Definition
(GenBank) hypothetical protein
Organism
nos  Nostoc sp. PCC 7107
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMT_2
Motif
Other DBs
NCBI-ProteinID: AFY45859
UniProt: K9QLC0
Position
6243597..6245210
Genome map
AA seq 537 aa AA seqDB search
MKTLSIQNHQRDFIWIKILVISIIILGIYFRFANIGHKVYWTDEVYTSLWLSGHSSSEII
EKFYHGEIVNLGILKEYQQINITQGISGAITRLALEDSQHPPLYYSLAWFWSAWFGNSVA
AIRSLSAIISVFSLVSVYFLCQELFELPLTKWVAILLIAISPFYVLYAQEAREYSLWKLT
IIISNYSFLLAFRKKSFFSWLIYAITLTLSFYTFLFSIFLALGHGIYILSIHGFKKTQSL
IAYLLSITAAIIAFIPWLIIIYQGRIAGRIQRLDWITEETSLPALIGKWLLNITRIFLDW
VIINENTSTKAIIWLIPFTFALIVLIGYGFYYLYRSMPKSTWLFILTLTLTTATALIIPD
IIFGGRRSGVARYLIPTFLGIQLTIAHLLASKLVAVQSIKWQNIWRLITIFIISIGVISC
VIISPAGIWWNKGAANNLRLDQVAAVINQSHHPVVVSDAKFPYILGLTHILNSDVNFQLA
IQPQDLVVQKAQDNLFLFYPSRKLYKYLKINYNLEPLYLGKNPVLGLWKLQAINQRN
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactctatctattcaaaatcatcaaagagactttatctggataaaaatccttgtt
atttctattataattttaggaatttattttcggtttgcgaatattggccataaagtttat
tggacagatgaagtttacacatcattatggctttctggtcattccagttcagagattatc
gaaaaattttatcatggtgaaattgttaatcttggtatcttaaaagaatatcaacagata
aatattacccaaggtatcagtggtgcaattactcgtctggctttagaagactctcagcat
ccaccactatattactctcttgcttggttttggtcagcttggtttggtaattctgtagct
gcaattagaagtttatctgccattattagcgtattttctttagtcagtgtatatttttta
tgtcaagaattatttgaattacctttaacaaagtgggttgctattttactgatagccatc
tcgccgttttatgttttatatgctcaggaggctagagaatatagtctgtggaaattgacg
attataatttctaattattcatttttattagctttcaggaaaaaatcatttttcagttgg
ttgatttatgcaattacactcactctaagtttttacacatttttgttttcaatcttttta
gcccttggtcatggcatttatatattaagtattcatgggttcaaaaaaactcagtcatta
attgcttatttattatctatcacagccgccattatcgcttttatcccttggctgataatt
atttatcaaggtagaattgctggcagaattcaacgattagattggataacagaagagacg
agtttacctgctttaattgggaaatggctgctaaatatcacgcgaatttttttagattgg
gtaattattaatgaaaatacatcaactaaagcaataatttggttgataccatttactttt
gcattgatagttttgattggttatggattttactatctctatcgttcaatgcctaaaagt
acttggttatttatattaactttaactttaacaacagcaacagccttaattattcctgat
attatctttggcggtaggcgttcgggagtggcgagatatctaataccgacatttttagga
attcaattaacaattgctcatcttttagctagtaagttagtcgcggttcaaagcataaaa
tggcaaaatatctggagattaattacgatttttatcatctctattggtgtgatatcttgt
gtaattatctctccggctgggatttggtggaataaaggtgccgcaaataatttaaggtta
gatcaagtcgctgctgttatcaatcaaagtcatcatcctgtagtagtcagtgatgctaaa
tttccatatattttagggttaactcatatacttaattccgatgtaaattttcagttggcg
attcagcctcaagatttggtggttcagaaagcacaagacaatttatttttgttttatcca
tcaagaaagttatacaaatatctgaagattaactataatttagaacctctatatctaggg
aaaaatccagttttgggtttatggaaattacaagctattaatcagcgcaattga

DBGET integrated database retrieval system