KEGG   Nostoc sp. PCC 7107: Nos7107_5375Help
Entry
Nos7107_5375      CDS       T02362                                 

Definition
(GenBank) regulatory protein TetR
Organism
nos  Nostoc sp. PCC 7107
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N TetR_C_11 DUF1956 HTH_22 LacI HTH_40
Motif
Other DBs
NCBI-ProteinID: AFY45860
UniProt: K9QJS1
Position
complement(6245194..6245811)
Genome map
AA seq 205 aa AA seqDB search
MARPKAGEIDRSNSTEKVEKILQGAMQEFLAHGYAATSMDKVAEAASVSKATVYSHFQDK
EGLFRALIEKLARKRFHSILGTQPLQGEPYIVLRRLAKTALDQMVNDQEYQAFERLLMGE
SARFPELAQVFIGSIAKPAIETISKYLASCTELNIPDPEATARILIGSLVHFVMTQEIMH
GKYIMPMESDRIIDALTHLIVNCAD
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcccaaaagcgggggaaattgaccgttcaaattcaacagagaaagtagaaaag
attctccaaggggcaatgcaggagtttctcgcccacggctatgctgctacgagtatggat
aaagtggcagaagcagccagtgtttctaaagccacggtgtacagccattttcaagataaa
gaaggcttatttcgggcattaatcgaaaaactggcaagaaagcggtttcattcaatttta
gggacgcaaccccttcagggagaaccttacattgtgctgcggaggttagccaaaacagca
ttagaccagatggtgaatgaccaggaatatcaagcatttgaacgcttactaatgggagag
tcagcgcggtttcctgaattagcacaagtgtttattggtagtattgccaaacctgcaatt
gagactatcagtaaatatttagcatcttgcacggaattgaacattcccgacccggaagcc
acagctaggatactcattggttcattagtacattttgtgatgacacaggagattatgcac
ggtaagtatattatgccaatggagagcgatcgcattatcgatgctttaacacacctaatt
gtcaattgcgctgattaa

DBGET integrated database retrieval system