KEGG   Nostoc sp. PCC 7107: Nos7107_5381Help
Entry
Nos7107_5381      CDS       T02362                                 

Definition
(GenBank) hypothetical protein
Organism
nos  Nostoc sp. PCC 7107
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFY45866
UniProt: K9QL45
Position
6252765..6253025
Genome map
AA seq 86 aa AA seqDB search
MDIRLIKKSEKLILKKIKQIEEENLSIDDFESQEATSEEKQVINVVENREDDYIPLRDNP
VVLSIANSGWQVSEILRDIRVDTFCD
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atggatatacgactcatcaaaaaatccgaaaaattaatcctgaaaaaaataaaacagata
gaagaagaaaatctttcaatagatgattttgagagccaagaagccacatctgaggagaaa
caagtaattaatgtagtagaaaatagagaggacgactatattccgttgcgagataatcct
gtagttttatctatcgccaattcaggatggcaggtttcggaaatcctcagagatatcaga
gtagatactttctgtgattga

DBGET integrated database retrieval system