KEGG   Nostoc sp. PCC 7107: Nos7107_5388Help
Entry
Nos7107_5388      CDS       T02362                                 

Definition
(GenBank) Sulfate-transporting ATPase
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
nos  Nostoc sp. PCC 7107
Module
nos_M00254  ABC-2 type transport system
Brite
Transporters [BR:nos02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    Nos7107_5388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_23 AAA_13 RsgA_GTPase AAA_22 AAA_16 AAA_29 AAA_15 AAA_33 AAA_24 AAA_28 AAA DUF4162 AAA_18 AAA_14 TsaE cobW Zeta_toxin AAA_30 CT_C_D NACHT AAA_25
Motif
Other DBs
NCBI-ProteinID: AFY45872
UniProt: K9QM59
Position
complement(6263695..6264645)
Genome map
AA seq 316 aa AA seqDB search
MVKELAIRTCGLTKQFERYIAVNDVDLEIQAGEVYGLIGPNGAGKTTLIRMLATAEEPTT
GEIYINGDRMVRDKSNPTIKRRLGYLPDDYPLYEDLTVWDYLDYFARLYRLREPRRTQRL
HEVLELIQLGNKRNSLIATLSRGMKQRLSLARTIIHEPILLLLDEPVSGLDPIARMQFRE
IIKALQEAGMTILISSHVLSDLAELCTSIGIMELGFLVESASLKHLYERLARQQIMLSTL
GKIDAVISELKNHPLVEAWEVLPGNHNIRVNFSGDQTACAELLRSLIQSGIPITDFHCTQ
EDLETIFLKLGHKQAS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaattagcaattcgcacctgtggactcactaagcaatttgaaaggtatata
gccgtcaatgatgttgatttagaaatccaagcgggtgaagtatacggactgatagggccg
aatggcgcgggtaaaacaactctcatccggatgttagcaactgctgaggagccaacaacg
ggtgagatatatattaatggcgatcgcatggtacgtgacaagagtaaccccactatcaag
cgtcgtcttggctacttacccgatgactatccgctatatgaagatttgacagtctgggat
tacctcgattactttgcgcggttgtatcgtttgcgcgaaccacgtcgcactcagcgtctc
catgaagttttagaacttatccaattaggtaataaacgcaacagtttaattgctacactg
tcgcggggaatgaagcagcgccttagtttagcacgtactatcattcatgaaccaatttta
ttactcctagatgaacccgtatctggacttgatcccatcgccaggatgcagttccgtgaa
attatcaaagctttgcaagaagctgggatgacaattttaatttcgtcccatgttctgagc
gatttagcggaactgtgtacttcaattggaattatggaactaggctttttagtagaaagt
gcttcactcaaacatctgtatgagcgtttagctcgacaacaaattatgttgtcaaccttg
ggaaaaatagacgctgtaattagtgaattaaaaaatcatcctttggtggaagcgtgggaa
gttttaccaggaaatcacaatatcagagtaaatttttctggtgatcaaacagcttgtgca
gaattactgcgatcgctgattcaatctggtatacccattactgattttcattgcactcaa
gaagacttagaaaccatttttctcaagcttggtcataaacaagcatcataa

DBGET integrated database retrieval system