KEGG   Nostoc sp. PCC 7107: Nos7107_5396Help
Entry
Nos7107_5396      CDS       T02362                                 

Definition
(GenBank) hypothetical protein
Organism
nos  Nostoc sp. PCC 7107
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF433
Motif
Other DBs
NCBI-ProteinID: AFY45879
UniProt: K9QLD5
Position
complement(6271370..6271750)
Genome map
AA seq 126 aa AA seqDB search
MQLEDYFNFLAPDDIRLQGTRVGIETILFDYLFRAKTPEEIAKTYTSLTLEQVYTTILYY
LHNQQAVDAYLKDWLEWGDRMREEQSRNPNPVVERLRKLKAEKMAIQTHGTEISRSYICR
LGGAIA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttgaagactactttaactttcttgcacctgatgatattagactccagggtaca
agagtaggaattgaaacaattttatttgactacctattccgtgctaaaactcccgaagag
attgctaaaacctatacttcacttactttagagcaggtttatactactattctctactac
ttacacaatcaacaagctgtagatgcttatttgaaagattggctagagtggggcgatcgc
atgagagaagaacaaagtcgcaaccctaatccagttgttgaaaggctacgtaaattaaag
gctgaaaaaatggcgatacaaactcatggcactgaaatatctcgtagttatatttgtagg
ttgggtggagcgatcgcgtaa

DBGET integrated database retrieval system