KEGG   Nostoc sp. PCC 7107: Nos7107_5397Help
Entry
Nos7107_5397      CDS       T02362                                 

Definition
(GenBank) acetyl-CoA carboxylase carboxyltransferase subunit alpha
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00061  Fatty acid biosynthesis
nos00620  Pyruvate metabolism
nos00640  Propanoate metabolism
nos01100  Metabolic pathways
nos01110  Biosynthesis of secondary metabolites
nos01120  Microbial metabolism in diverse environments
nos01130  Biosynthesis of antibiotics
nos01200  Carbon metabolism
nos01212  Fatty acid metabolism
Module
nos_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:nos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Nos7107_5397
   00640 Propanoate metabolism
    Nos7107_5397
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Nos7107_5397
Enzymes [BR:nos01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     Nos7107_5397
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Nos7107_5397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans TF_Zn_Ribbon OrfB_Zn_ribbon
Motif
Other DBs
NCBI-ProteinID: AFY45880
UniProt: K9QJT6
Position
6272460..6273533
Genome map
AA seq 357 aa AA seqDB search
MANERQLRQRRKPLQRTCFPKILVPNDKRLFSTHTHLNKIKMANNEESRGLKSLFDWFAN
RRKSGSTNLERQEREIADGLWHKCSKCGVLTYTKDLRANQMVCVECGHHNRVDSDERIRQ
LIDNNTWQPIDEHLRPTDPLQFRDRKPYSDRLRETESKIGLIDAVKTGLGQINGMPVALA
VMDFRFMGGSMGSVVGEKITRLIEQATGRRYPVVIVCTSGGARMQEGMLSLMQMAKISAA
LDRHRDARLLYIPVLTNPTTGGVTASFAMLGDIILAEPKSTIGFAGRRVIEQTLREKLPD
DFQTAEDLLKHGFVDDIVPRTQLKNTLSQLIALHQPITTAPSMMLWESMTLSSTAVE
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgaacgccagttgcgacaacggaggaaacctctgcaacgcacttgtttcccc
aaaatactggttcctaatgacaaaagactgttttcgacccatacccacttgaataagata
aaaatggcaaacaacgaagaatcacgcggtttaaagtctctgtttgattggtttgcaaat
cgaagaaaatcaggctctaccaacctggaacggcaagaacgggaaattgctgatgggtta
tggcacaagtgttctaagtgtggtgttttaacctatacaaaagatttgagagctaatcaa
atggtctgcgttgaatgtgggcatcataatcgggtagatagtgatgaacgcatccgccaa
ttgatagataacaacacttggcaaccgatagatgagcatttgcgtccgacagacccctta
caattccgcgatcgcaaaccttatagcgatcgcctccgggaaacagaaagcaaaatcggt
ctcatagacgcggtgaaaaccgggttgggacaaatcaacggaatgcccgtagccttggct
gtgatggacttccgttttatgggtggtagtatgggttccgttgttggcgaaaaaatcacc
cgcttaattgaacaagcaactgggcgacgttaccctgtagttattgtctgcacctctggt
ggtgcaagaatgcaggaaggtatgctttccctgatgcagatggcgaaaatctccgcagct
ttagaccgccatcgtgatgctagattattgtatattcctgtgttgactaaccccacaact
ggtggtgtaactgcgagttttgccatgttaggcgatatcattttggcagaacctaaatca
accatcggtttcgctggtcggcgcgtgattgagcaaaccctccgggaaaaactgccagac
gattttcagactgctgaagatttgctcaagcatggctttgtggacgatattgtaccccgt
actcagttaaagaataccttgtcccagctaattgctttacaccaaccaattacaaccgcc
ccttcaatgatgttgtgggagtcaatgacattgagttctacagcagttgaataa

DBGET integrated database retrieval system