KEGG   Nostoc sp. PCC 7107: Nos7107_5398Help
Entry
Nos7107_5398      CDS       T02362                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
nos  Nostoc sp. PCC 7107
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-ProteinID: AFY45881
UniProt: K9QL54
Position
complement(6273645..6275021)
Genome map
AA seq 458 aa AA seqDB search
MDSVQVETAASPILEISQIVTPTTTLVPSKKPVFCISKDGIRTSLRASTLDAILATVFGI
TTGGILLSNFLVELDASPVVFGMLSSIPMLVNLIQPLGAYLSERTTSRFRYALGIYGTAR
LVWLILAIAIAVFSWGGISSQQLVLMTLLIVLATHLLGGLGCASWMSWLAMIVPRRLRGR
YFGIRNSAVSLTNLICLPLAGLVVSHWYGGNIQGYGVVLLIGVVFGIVSISCQYFKVDIN
PQLQNSLGSTSIKNTNELVSLPNTSIWKNYNFLILLIYISLWMFAVHLSAPFFNLYMLDT
LGIDVSWVTLYGSLQAGANLLMMIWWGKLADRVGNLPILIFVGIMVGLTPILWLGINANQ
LDIWLWLPLLHILAGVTWAAIDLCNNNLQLAIAPIKNQSIYFAIAAAVAGGSGALGTTIG
SVIAQFAIWDGLLGLFALSGLLRLAALVPLFFVQEPGR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggattctgttcaggtcgaaacagctgcttctccgattctggaaatatcccagattgtt
acaccaacaactacacttgttcctagcaaaaaacctgtcttctgtatttctaaggatggg
attcgtactagtttacgcgcctctacgctggatgctattttagcaacggtttttggaatt
actactggaggtattttactcagtaatttcctcgtggaattagatgctagtccagtggta
tttgggatgttatcttctatacctatgctggtaaatctcattcagcctttgggtgcatat
ttatcagaacgcactacgagccgttttcggtatgcgctggggatatatggaactgctcgc
ctagtatggctaattttagcgatcgctattgctgtttttagttggggcggtataagttca
caacagttagttttgatgactctgttaattgttttagccactcatcttttaggcgggtta
ggttgtgcatcgtggatgagttggttagcaatgatcgttccgcgacgattgcgcggccga
tattttggaattcgcaacagtgcggttagcttaactaatttgatttgtctgcctttagct
ggtttagtggtatctcattggtatggcgggaatatccaaggttatggggtagttttgcta
attggggttgtgtttggcattgttagcattagctgtcaatatttcaaggtagacattaat
cctcaattacaaaattctttgggttctacttctattaagaatacaaatgaattagtttct
ttacctaatacaagtatttggaaaaattataactttttaatattgctaatttatatcagt
ttatggatgtttgctgttcatttgagcgcacctttttttaacctctatatgctggatacg
ttgggtatagatgtgagttgggtgacgctttacggcagtttgcaagctggggctaacttg
ttgatgatgatttggtggggcaaattagcagatagagttggtaatctgccaattttaatt
tttgtgggaattatggtaggactgacaccaattttgtggttaggaattaatgccaatcaa
ctggatatttggctatggttgccacttttacatattttggctggtgtgacctgggcagcc
attgatttgtgtaataacaatttacaattagcgatcgcaccaattaaaaatcagtcaatt
tattttgcgatcgcggcggctgtggctggtggtagcggtgctttaggcacaaccatcggc
agtgttatcgcccaatttgctatttgggatggcttactgggattattcgctctctctggc
ttgttgcgcctagccgcacttgtcccactgttttttgtccaagaacctggaagataa

DBGET integrated database retrieval system