KEGG   Nostoc sp. PCC 7107: Nos7107_5401Help
Entry
Nos7107_5401      CDS       T02362                                 

Definition
(GenBank) carbohydrate ABC transporter membrane protein 1, CUT1 family
  KO
K02025  multiple sugar transport system permease protein
Organism
nos  Nostoc sp. PCC 7107
Module
nos_M00207  Putative multiple sugar transport system
Brite
KEGG Orthology (KO) [BR:nos00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nos02000]
    Nos7107_5401
Transporters [BR:nos02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter [MD:M00207]
    Nos7107_5401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AFY45884
UniProt: K9QLD9
Position
6279143..6280036
Genome map
AA seq 297 aa AA seqDB search
MLQINRRQNLTENLAGYLFLAPTILVLGTFVVLPILYAVFLSLHKVQLLGEIEYEFIGFH
NFSRLVEDERVWIALKNTAEYVAIVVPSQTLLALVLAVTLNSGIRGKNWWRILYFLPTVT
SSAVLTLIFMWIYNTDGLLNDGLAFVGLPTYNWLGDPSVALKGIMMMNIWSTAPFYMVIY
LAALQDIPQKLYEAAELDGANTWQQFIYVTIPLLKPVTFFVVAIGIIGTFQLFDQSYIFS
GGTGGPNNATLTLVLLIYQAVFRNLQMGYAAAIAFLLAVVIITITLIQRHLFGGEKM
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaaattaacagacggcaaaatctgacagaaaatctggctggatatctgtttctc
gcacccactattctggttttgggaacttttgttgtattacccattctctacgccgttttt
ctgtcgttacacaaagtccaacttctcggcgaaattgaatatgagtttatcggctttcac
aatttcagccgcttagttgaagatgaacgcgtttggattgctttaaaaaatacggcggaa
tacgtggctattgtcgtacctagccaaactcttttggctttggttttggcagtaactctc
aactccgggattcgtgggaagaattggtggcgcattctctactttttgcccacagtgact
tcttccgccgtgctgacactgatttttatgtggatttataacacggatgggctactgaac
gatggtttagcttttgtgggtttacctacttataactggttaggtgatccatctgtggca
ctgaaaggcatcatgatgatgaatatttggtcaactgcgccgttttatatggtgatttat
cttgcggcgttgcaagatattccccaaaaattgtacgaggcggcagaactggatggggca
aatacttggcagcagtttatttacgtaacaattccgttactcaaacctgtaacttttttt
gtcgtagccatcggaattatcgggacttttcaattatttgaccagtcttacattttttct
ggtgggactggcgggccgaataatgcgacgctgactttggtgttgctgatttatcaagca
gtatttcgcaatttacagatgggttatgcagcggcgatcgcatttttattagctgtagta
attatcaccataactttaattcagcggcatttatttggaggcgaaaaaatgtga

DBGET integrated database retrieval system