KEGG   Nostoc sp. PCC 7107: Nos7107_5412Help
Entry
Nos7107_5412      CDS       T02362                                 

Definition
(GenBank) hypothetical protein
Organism
nos  Nostoc sp. PCC 7107
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFY45895
UniProt: K9QJV0
Position
complement(6290888..6290989)
Genome map
AA seq 33 aa AA seqDB search
MLTPDTVRVAANYEILAVFIELIHGIFIISVNK
NT seq 102 nt NT seq  +upstreamnt  +downstreamnt
atgctgactcctgacacagttcgggtagccgccaattatgaaattttagctgtttttatt
gagttaattcatggaatctttatcatttctgtcaataaatga

DBGET integrated database retrieval system