KEGG   Nostoc sp. PCC 7107: Nos7107_5415Help
Entry
Nos7107_5415      CDS       T02362                                 

Definition
(GenBank) lipase class 2
  KO
K01046  triacylglycerol lipase [EC:3.1.1.3]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00561  Glycerolipid metabolism
nos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nos00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Nos7107_5415
Enzymes [BR:nos01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     Nos7107_5415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipase_2 Abhydrolase_1 PGAP1 DUF676 DUF915 Hydrolase_4 Abhydrolase_6 Thioesterase Abhydrolase_5 Esterase FSH1
Motif
Other DBs
NCBI-ProteinID: AFY45898
UniProt: K9QKK4
Position
complement(6292621..6293298)
Genome map
AA seq 225 aa AA seqDB search
MNTINQQYNPVLLIHGISDTEAVFRKMRNYLQDKGWSVYALNLVPNNGDVGLDILAQQVA
DYIAATFAPEQTLDIVGFSMGGIVSRYYVQRLGGIERVQRLITISSPHHGTYVAYGSWRP
GCEQMRTHSNFLKDLNSDAVMLKQLNFTSIWTPYDLMIVPAKSSQMPIGTEVIIPAASHP
WMLTDSRSLAAVATALAEPIQNINRDRQFGYTHNYQISPLGSGNT
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaataccattaatcagcaatataatcccgtcttattaatccacggcattagcgatacg
gaagcagtcttccgcaagatgcgaaattatttacaagataagggttggtctgtgtatgct
ctcaatctagtaccgaataatggtgatgttggcttagatatattagcacagcaagtagct
gattatattgccgcgacctttgcaccagaacaaacactagatatagtcggttttagtatg
ggcggaattgttagtcgttattatgtccaaagactgggcggaattgagcgcgtgcaaagg
ttgatcaccatctcatcgcctcatcatggaacttatgttgcttatggttcttggcggcca
ggttgtgaacaaatgcgtactcacagtaacttcctcaaagatttaaactctgacgctgtg
atgttaaagcaattgaactttacctcgatttggacaccttacgatttgatgattgtccca
gcaaaaagttcgcaaatgcccataggtacagaagtaattatccccgcagcatcgcaccct
tggatgttaactgattccaggagtttagccgcagtcgccacagccttagccgaacccata
cagaatattaaccgcgatcgccaatttgggtatactcataactaccaaatatcgcctctg
ggtagcggtaatacttaa

DBGET integrated database retrieval system