KEGG   Nostoc sp. PCC 7107: Nos7107_5419Help
Entry
Nos7107_5419      CDS       T02362                                 

Definition
(GenBank) Unspecific monooxygenase
Organism
nos  Nostoc sp. PCC 7107
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450 DNAP_B_exo_N Coat_F
Motif
Other DBs
NCBI-ProteinID: AFY45902
UniProt: K9QM83
Position
complement(6296059..6297450)
Genome map
AA seq 463 aa AA seqDB search
MPKDVFELSAPPVNSIVGHLQQLGQDPLGFLSRCRDYGDIVPLQLGLTSACLVTNPEYIE
EVLKNRTDFIKSRGLRSLKTLLGEGLLTAEGESWFWQRRLAQPVFHQKRINVYSQIMVDY
TNQMLQTWGDGETHDIHADMMGLTLEIVMKCIFSAEVDAGEAKVVAHALDVAMNWFESKR
KQNFLVWEWFPRPENINYRQAIAQMDEAIYKLIQARRNSKEKTNDLLTMLMEAKDEQTGQ
QMDDKLLRDEVATLMLAGHETTANTLSWTWMLLSQNPQVREKLQSELDQVLQGKSPTLED
LGKLVYTQQVIKESMRLYPPVSLMGREAAVDTQIGDYEIPQGTSIMISQWVMHRHPKYFE
NSEVFQPERWTEELEKQLPKGVYIPFGDGPRICIGKGFAQMEAALLLATIAQNFQIDLVP
GYPIVPQPSITLRPENGLKVEIKKIKLNAAEDGKKPVSGANIV
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaagatgtatttgagttatcagcaccgccagttaattctattgttggtcatctc
cagcaactggggcaagatccgttagggtttctcagccgttgtcgtgattatggtgatatt
gttcccttgcagttagggttaacatctgcttgtttagttactaaccctgaatatatagaa
gaagttctcaaaaatcgcaccgattttattaaaagccgcggcttacgtagtttaaaaact
ctcttaggagaaggcttattaacagcagaaggcgaatcttggttttggcagcgtcgcctt
gcacaaccagtatttcaccaaaagcggattaatgtatatagccaaatcatggtggattac
accaaccaaatgttgcaaacttggggtgatggtgaaacccatgatattcatgcagatatg
atgggtttgacgttagaaattgtgatgaagtgcatatttagtgctgaggtggatgctgga
gaagcaaaggtggttgctcatgcactggatgtagcaatgaactggtttgagagtaagcgg
aagcagaattttctggtgtgggagtggtttcctcgaccagaaaatatcaattatcgtcag
gcgattgcccaaatggatgaagctatctacaaactaatccaagcacgtcgcaatagtaaa
gaaaaaactaatgatttgttgacaatgttaatggaagcgaaggacgaacaaaccggtcag
caaatggatgataaattgctgcgggatgaagtcgctaccttaatgttggcaggacatgaa
actaccgccaatactttatcttggacgtggatgcttttatcacaaaatccccaagtgcgg
gaaaaattacaatcagaacttgatcaagtcctgcaaggaaagtcaccaactctcgaagat
ctaggaaagctggtttatacacagcaagtaatcaaagaatcaatgcgcttatatcctcct
gtctctctgatgggacgggaagccgcagtagatacgcagattggtgattacgaaattccc
caaggtacatcaatcatgattagccaatgggtaatgcaccgtcatcccaaatattttgag
aactccgaagtttttcaaccagaacgctggacagaagagttagaaaaacaactccccaaa
ggagtgtatattccttttggtgatgggccaagaatttgtattggtaaaggtttcgctcag
atggaagcggctttgttattagcgactattgctcaaaatttccaaatagatttagtgcca
ggatacccaattgttccccagccttcaattacgttacgtccagaaaatggactgaaggtg
gaaatcaaaaaaattaagttgaacgctgctgaagatgggaaaaaaccagtgtctggtgca
aacattgtttag

DBGET integrated database retrieval system