KEGG   Nostoc sp. PCC 7107: Nos7107_5420Help
Entry
Nos7107_5420      CDS       T02362                                 

Definition
(GenBank) ABC exporter ATP-binding subunit, DevA family
  KO
K02003  putative ABC transport system ATP-binding protein
Organism
nos  Nostoc sp. PCC 7107
Module
nos_M00258  Putative ABC transport system
Brite
KEGG Orthology (KO) [BR:nos00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nos02000]
    Nos7107_5420
Transporters [BR:nos02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    Nos7107_5420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_30 AAA_25 AAA_29 AAA_16 T2SSE AAA_23 cobW RsgA_GTPase NTPase_1 AAA_33 AAA_22 AAA_19 AAA PhoH ATPase_2 Rad17 NACHT RuvB_N NB-ARC AAA_18 MobB
Motif
Other DBs
NCBI-ProteinID: AFY45903
UniProt: K9QKK7
Position
complement(6297625..6298332)
Genome map
AA seq 235 aa AA seqDB search
MVNEPVISIQNLNHYFGKGQLQKQVLFDVTLEINTGEIVIMTGPSGSGKTTLLTLIGGLR
SAQVGGSLQVLKQELCGANAAELTLARRHNGYIFQAHNLHNSLTAIQNVRMALELHNNLS
VKQMLERSAQMLDLVGLGHRLNYYPDDLSGGQKQRVAIARALVNNPQIVLADEPTAALDS
KSGRDVVNLMQTLAKEQGCTILLVTHDNRILDIADRIVYMEDGKLTNNSVVSLAS
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggttaacgaacctgtaatttctattcagaatctcaaccattattttggtaaaggtcaa
ttacaaaaacaagttttgtttgatgttaccttagaaataaatactggtgaaattgtgatt
atgacagggccttcgggttctggtaaaactaccttactcaccttaattgggggattgcga
tcggctcaagttggggggagtttgcaagttttaaaacaagaactttgtggtgctaatgcc
gcagaattgaccttagcacgcagacacaatggctatatatttcaagcacataatttgcac
aatagtttaaccgctatccaaaacgtcagaatggcgttggaactacataataatttgtca
gtcaaacagatgctagaacgttcggcacaaatgctggacttagttggcttgggtcatcgc
ctaaattattatcctgatgatttatctgggggacaaaaacaacgggtggcgatcgcgcga
gctttagtcaacaatccgcaaatcgttctagctgacgaacccacggcggctttagatagt
aaatctggacgagatgttgtcaatttgatgcagacattagctaaagaacaaggctgtact
atcttacttgtaactcatgataatcgaattctggatattgccgatcgcattgtctatatg
gaagatggcaaattaactaataactctgttgtcagtttggcttcataa

DBGET integrated database retrieval system