KEGG   Nostoc sp. PCC 7107: Nos7107_5422Help
Entry
Nos7107_5422      CDS       T02362                                 

Definition
(GenBank) ABC exporter membrane fusion protein, DevB family
  KO
K02005  HlyD family secretion protein
Organism
nos  Nostoc sp. PCC 7107
Brite
KEGG Orthology (KO) [BR:nos00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    Nos7107_5422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl_2 HlyD_D23 HlyD_3 Biotin_lipoyl Peptidase_M23 RnfC_N PEP-utilisers_N
Motif
Other DBs
NCBI-ProteinID: AFY45905
UniProt: K9QJV8
Position
complement(6299570..6300760)
Genome map
AA seq 396 aa AA seqDB search
MLQNLPAKASSATVRQWMGLGATALIVVGGVSAYLLFQSASKPQIENQNAAISSPQITTV
TALGRLEPQGEIIKLSAPTANNGNRVDQLLVKQGDRVKIGQVIAILDSRDRLFAAYQQAQ
EDVKVAQAKMAITKAGAKTGEINAQRAEIARLEAQRLGDIDAQAATVARLTSEQTNALKQ
YNRYQSLYEQGAISAADRDSRQLALDTAQKSLQEAQAILERIQSTSPAQLNQAKANLERI
AEVRPVDVKQNQAEIDRAVAAIKQAKAELDQAYVRSPMNGEILEIHTHAGEVVGTDGIVE
IGQTQQMYAVAEVYQSDISKVKLGQKVRVSSDSIPGELLGKVERIDSQVKRQNVVNTDPS
TNIDGRVIEVHIALDAASSKKAAKFTNLQITAEIEQ
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaaaacttaccagccaaagcttcttcagctacagttcgtcaatggatggggtta
ggggcgacggcgctgattgttgtgggtggggtttctgcttatctactgttccaatcagca
tcaaagccacagatagagaatcaaaacgccgccatcagttcaccgcaaattaccacagtg
acggccttggggcggttagaacctcaaggagaaatcattaagttgtcagcaccgaccgca
aataacggcaatcgggtagaccaattactagtgaaacaaggcgatcgcgtcaagatagga
caagtgattgcaattttggatagtcgtgatcgcctgtttgcagcctatcagcaagcgcag
gaagatgtgaaagttgcccaagctaaaatggcgattaccaaagccggggcaaaaaccggc
gaaatcaacgctcaacgtgcagaaatcgcgcgtctggaagcacagcgcttaggtgatatt
gatgctcaagctgcaaccgtcgcgcggttaacctcagagcaaacaaatgccctcaaacaa
tacaaccgctatcaatcgttgtatgaacagggtgcaatttccgcggctgatcgagatagc
agacagttagctttagataccgcacaaaagagtttacaagaagcacaagcaatattagaa
cggattcaatcaactagtccagcacaactcaatcaagccaaagctaatttagagcgcatt
gctgaagtccgtccggtggatgtcaaacaaaaccaagcagagattgatcgggctgttgcg
gcgattaaacaagccaaggccgaacttgatcaagcttatgtgcgatcgccaatgaatggg
gaaattctcgaaattcatacccacgcgggcgaagtggttgggactgatgggattgtagaa
attggtcagactcagcagatgtatgcagttgccgaagtttatcaaagcgacattagtaaa
gtcaaactgggacaaaaagtgcgtgtcagcagtgattctatccccggtgaactactcgga
aaagtagaacgtattgattcccaagttaaacggcaaaatgttgtcaacactgaccctagc
accaatattgatggccgggtaatagaagtgcatatcgccttagatgctgcatccagtaaa
aaagccgctaaatttaccaacttgcaaattacagccgaaatcgaacaatga

DBGET integrated database retrieval system