KEGG   Nostoc sp. PCC 7107: Nos7107_5423Help
Entry
Nos7107_5423      CDS       T02362                                 

Definition
(GenBank) transcriptional regulator, TetR family
Organism
nos  Nostoc sp. PCC 7107
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N TetR_C_7 HTH_7 DUF1956 TetR_C_11 HTH_Tnp_1_2
Motif
Other DBs
NCBI-ProteinID: AFY45906
UniProt: K9QL74
Position
6301040..6301642
Genome map
AA seq 200 aa AA seqDB search
MKSKSVERDLSPEKTKAILDGAMQEFLENGYAAARIDKIAVAAGVSKATIYRRFPDKETL
FIELVQQLACEKELFNPNHLLSAQGDVASFLKSFANMMLTHVADDPQSLTFLRIIIGESG
RFPQLARAFVQNIEKPMLQAMTHYLGSHPELELPDPEVAARAFMGTLIHFVLLRDVLHSG
DIVPIERDRLVDQLVKLIIK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccaaaagtgttgagcgcgatttatctccagaaaagacgaaggctattttagat
ggagcaatgcaagagtttttagaaaacggctatgctgctgccagaattgataaaattgcc
gtagcggcaggtgtttctaaagcgacaatttatcggcgctttcctgacaaagagacttta
tttatcgaactggtacagcaattggcttgcgaaaaagagctttttaatccaaatcatctg
ctatcggctcaaggtgatgtagcttcattcttaaaatcctttgccaatatgatgctcacc
catgttgcagatgatccccaaagcttgacattcttgcggattattatcggtgaatcagga
cgctttccccaattagcacgagcctttgtgcagaacattgaaaaaccaatgctgcaagcc
atgacacattatctaggctctcacccagaattagaactcccagacccagaagttgcagcg
cgagcctttatgggaacactgattcattttgttctactgcgagatgtgttgcacagtggt
gatattgtacccattgagcgcgatcgcctggttgatcagctagtcaaactaattattaaa
taa

DBGET integrated database retrieval system