KEGG   Nostoc sp. PCC 7107: Nos7107_5429Help
Entry
Nos7107_5429      CDS       T02362                                 

Definition
(GenBank) coproporphyrinogen III oxidase, anaerobic
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00860  Porphyrin and chlorophyll metabolism
nos01100  Metabolic pathways
nos01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nos00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Nos7107_5429
Enzymes [BR:nos01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     Nos7107_5429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AFY45911
UniProt: K9QL76
Position
complement(6309536..6310918)
Genome map
AA seq 460 aa AA seqDB search
MVFISPGVKFDLDLIKKYDTAAPRYTSYPPATELSEAFTTADFHSAIAASNQRQSPLSFY
FHIPFCQSACYFCGCNTVISNNKNIAKPYLEHLAQEIKNMSNLISPDRKVLQMHWGGGTP
NYLDLEQVEFLWKKITQHFDFDPQAEISIEISPRYVDKEYIFFLRELGFNRVSFGIQDFN
NEVQVAVNRIQPEELLFNVMDWIKAAKFDSVNVDLIYGLPYQTLQTFRETIKKTVALDPD
RIVVFNFAYVPWLKPAQKNIPPEALPKPQEKLEILEMTIEELTNSEYLFIGMDHFAKPND
ELAIAQRNRTLQRNFQGYTTHAGTDLFGFGATSISMLNDAYVQNHKQLKDYYQAVANHVL
PVSKGIKLTQDDIIRRDVIMCIMSHFQLYKQDIAEKYHINFDQYFSQELEALQPLAADGL
IKLSAHHIQITDIGRLLVRNIAVVFDAHNQKQDKQFSRAI
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggtattcatatcacctggtgtcaaatttgatttggatttgatcaaaaagtacgacaca
gcagcaccaagatacaccagttatccaccagcgacagagttaagcgaagcatttacaacg
gctgattttcacagtgcgatcgccgcttccaatcaaagacaatctccgctatcattttat
ttccacattcctttttgccaaagtgcttgttatttctgtggctgtaatacagtaatttcc
aacaacaagaatattgccaaaccttatctagaacatttagctcaagaaatcaagaatatg
tctaacttgatttctcccgatagaaaggtattgcaaatgcactggggtggtggtacaccc
aactatttagacttggaacaagtagaatttctctggaagaagattacacaacactttgat
tttgacccccaagccgaaatttccattgaaattagtccccgttacgtggataaagagtat
attttctttctgcgggaactcggatttaatcgcgttagttttggtatccaagactttaac
aatgaagttcaagtagctgtcaaccgcattcagccagaagaattattattcaatgtcatg
gactggattaaagcagccaagtttgacagtgtaaatgtggatttaatttatggtttacct
tatcaaactctccagacatttcgagagacaatcaaaaagacagttgcattagatcctgac
cgaattgtggtgtttaactttgcttatgtcccttggttaaaaccagcacaaaaaaatata
cctccagaggctttaccaaaaccccaagaaaagttagaaattttggaaatgaccattgag
gaattaaccaatagcgagtatttatttattgggatggatcactttgctaaacctaacgat
gaattagcgatcgcccaacgaaatcgcaccctccaacgcaactttcaaggttatactact
catgctggcacagatttgtttggttttggtgccacttctatcagtatgttaaacgatgcc
tacgtccaaaaccataagcaattaaaagattattatcaggcagttgctaaccatgtcttg
cctgttagtaaaggtatcaaactaactcaagatgatattatccgccgagatgtaatcatg
tgcattatgtcgcactttcagttgtacaaacaagatattgctgagaagtatcacatcaac
tttgatcaatatttctcccaagaactagaagcattacaaccattagccgcagatggactg
attaaattatctgcccatcacattcaaattaccgacatcggcaggttattggtgagaaat
attgctgttgtttttgatgctcataatcaaaaacaagataaacaattttcgcgtgcaatt
taa

DBGET integrated database retrieval system