KEGG   Nostoc sp. PCC 7107: Nos7107_5430Help
Entry
Nos7107_5430      CDS       T02362                                 

Definition
(GenBank) Heme oxygenase
  KO
K21480  heme oxygenase (biliverdin-producing, ferredoxin) [EC:1.14.15.20]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00860  Porphyrin and chlorophyll metabolism
nos01100  Metabolic pathways
nos01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nos00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Nos7107_5430
Enzymes [BR:nos01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.20  heme oxygenase (biliverdin-producing, ferredoxin)
     Nos7107_5430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Heme_oxygenase AbrB-like
Motif
Other DBs
NCBI-ProteinID: AFY45912
UniProt: K9QM92
Position
complement(6311322..6312038)
Genome map
AA seq 238 aa AA seqDB search
MSSNLAVKLRSGTQKAHTAAENVGFMKCFLKGVVDKDCFAKFLGNLYFVYTELETALASH
QNNPVIGGMYFPELNRRAALETDMVFYYGNDWRSLITPSNNAKKYIARIQQLSASAPALL
IGHAYTRYMGDLSGGQMLQKIAQSTLKLSGYEGTSFYNFDQIPDKKAFKDKYRDGLNAVP
VDDVTAEKIVAEANHAFSLNMQMAEELEGSLIRAIGQVLFNNLTGSHNPGSTEAAATN
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtaatttagctgtcaaactgcgttctggtacgcaaaaagcgcacacagcagca
gaaaatgtcggattcatgaaatgttttctcaaaggtgttgtcgataaagactgctttgca
aagtttcttggtaacttgtattttgtttacaccgaactagaaacagccttagccagtcac
caaaacaatccggtaattggtgggatgtactttcctgaactgaatcgccgggcagcttta
gaaacagacatggtattttactatggcaacgactggcgaagtttaatcacaccttccaac
aatgccaaaaaatacatcgcccgcattcaacaattatctgcatctgcacctgcattatta
atcggtcatgcctacacccgctacatgggcgacctgtcaggtggtcagatgttacaaaaa
attgcccagtcaaccctgaagctgtctggctacgaaggaacatctttttataactttgac
caaattcccgacaaaaaagcctttaaagacaaataccgggatgggttaaacgctgtacct
gtggatgatgtcacagccgagaaaattgtggctgaagccaatcatgcctttagtttgaat
atgcaaatggctgaagaactagaaggtagtttaattagagcgatcggtcaagtactattt
aataacctgactggttctcataacccaggcagcactgaagcagccgccactaattaa

DBGET integrated database retrieval system