KEGG   Nostoc sp. PCC 7107: Nos7107_5431Help
Entry
Nos7107_5431      CDS       T02362                                 

Definition
(GenBank) Mg-protoporphyrin IX monomethyl ester (oxidative) cyclase
  KO
K04035  magnesium-protoporphyrin IX monomethyl ester (oxidative) cyclase [EC:1.14.13.81]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00860  Porphyrin and chlorophyll metabolism
nos01100  Metabolic pathways
nos01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nos00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Nos7107_5431
Enzymes [BR:nos01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.81  magnesium-protoporphyrin IX monomethyl ester (oxidative) cyclase
     Nos7107_5431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rubrerythrin
Motif
Other DBs
NCBI-ProteinID: AFY45913
UniProt: K9QKL5
Position
6312510..6313586
Genome map
AA seq 358 aa AA seqDB search
MVDSVATPEPQLLKPGIKAPVAETLLTPRFYTTDFDAVAKLDISANEAEIRAIVDELRAD
YNRHHFVRDDEFKQSWDHITGEKRRTFIDFLERSCTSEFSGFLLFKELSRRLKKNNPLLS
EAFEYMARDEARHAGFLNKSMADLKLSLDLNFLTKSRTYTFFPPEWIIYTVYLSEKIGYW
RYILVNQHMQEHPEYQFYPLFRKFESWCQDENRHGDFFKALLRSQTKLWKSWTAKLWVRF
FLLTVFATHTMTVFERASFYEAIGIHPRKYNNRVIQETNNTSARAFPLILNTNHPEFFWR
LEQCSENNLKIAAINKSNQPSLVKLFQRIPPIIAIVWNMLQLYLIKPIDTESTRGTVL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggtcgattcagtggcaactccagagcctcaattgctgaagccgggtattaaagcacct
gttgcagaaacattattaacacctaggttttacaccactgactttgatgcagtggcgaaa
ttggacatatcggctaatgaggcagaaatccgggcgattgttgatgaactgcgtgcagac
tataaccgccatcactttgtgcgggatgatgaatttaaacaatcatgggatcacattaca
ggtgaaaaacgccgcacctttattgactttttagaacgctcttgtacctcagaattttct
gggtttctcttatttaaagaattatcgcgccgcctgaaaaaaaataacccgctgttatca
gaagcctttgaatatatggctagagatgaagctcgccatgcaggattcctcaacaaatca
atggcagatttaaaactttctctagacttaaactttttaactaaatcccgtacatatact
ttcttcccgccagagtggattatttacacagtttacctatcggagaagattggttactgg
cgttatatcttagttaatcagcacatgcaggagcatccagaataccaattttatccactg
ttccgcaaatttgagagttggtgtcaagacgaaaatcgacatggggatttctttaaagca
ttgctgcgatcgcaaaccaaactctggaaaagttggacagcgaaattgtgggtgcggttc
tttttgctgactgtgtttgctacccatacaatgacagtatttgaacgagcctcattttac
gaagcaattgggattcatccccgtaaatacaacaaccgagttattcaagaaacaaataac
acttctgcacgcgcatttcccctcatcctcaatacaaatcacccagaatttttctggcgc
ttagaacagtgttctgagaataacttgaaaatcgctgcgattaacaaaagtaatcaacca
agtttggttaaattattccaaagaataccgccaattatcgccattgtttggaatatgttg
cagctatatctcatcaagccaattgatacagaaagcacacgcggcacagttctttag

DBGET integrated database retrieval system